KEGG   Sulfurimonas autotrophica: Saut_0752Help
Entry
Saut_0752         CDS       T01316                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sua  Sulfurimonas autotrophica
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saut_0752
  Amino acid metabolism
   00300 Lysine biosynthesis
    Saut_0752
Enzymes [BR:sua01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Saut_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
736754..737854
Genome map
AA seq 366 aa AA seqDB search
MDVIQLFKYLINSKSETPDDGGILNFVEDYLEGFKAVRIDVEDVKNLFIYKKFGDGEHLC
FAGHVDVVPAGDGWDTNPYEAVEKDGFIYGRGTQDMKSGVAAFTQAVKEAKNFQGTLSLI
LTSDEEGEATAGTVKALEYLQQHNMLPDACVVAEPTCEDKFGDAIKVGRRGSINGYLTVK
GKQGHAAYPEKAINPIHQIAQVLGDMAGVDLDEGDEFFAPSKFVITDIRSGMQVTNVTPN
ELQMMFNVRNNTKTTQKEVREFVAKHLQGLDYELRLTQGSYPFKTDTDTKLVKKIDEAIK
QVTCKEPKHSTAGGTSDARFIAPLGVDVIEFGVRNDTIHSTNERTTKKEVEDLYRVFSRL
IENWNK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtggatgttattcaactttttaaatatctgataaattcaaaaagtgaaacgcctgatgat
ggcggtattttgaactttgtagaagattaccttgaaggctttaaagcagttagaattgat
gtagaagatgtgaaaaatctttttatttataaaaaatttggtgatggagaacatttatgc
tttgcagggcatgttgatgttgttcccgcaggagatggctgggataccaatccgtatgag
gctgtagaaaaagatggctttatctatggacgtggcacacaggacatgaaaagcggtgtt
gctgcatttacacaggctgtaaaagaagcaaaaaactttcaaggcacactctctttgatc
ttaacatcagatgaagagggtgaggcaacagcaggcaccgtaaaagcattagagtattta
cagcaacataatatgcttcccgatgcctgtgttgttgccgagcctacatgtgaagataaa
tttggagatgccataaaagttggacgtcgaggctctattaacgggtatcttacagttaaa
ggcaagcagggacatgctgcataccctgagaaggcaataaacccaatacaccaaatagca
caagtattgggtgatatggcgggcgttgatttagatgagggtgacgagttttttgctcct
tcaaagtttgtcattacagatatacgttcagggatgcaggtgacaaatgtaaccccaaat
gaacttcaaatgatgtttaatgtcagaaacaatacaaaaacaacgcaaaaagaggttcgt
gaatttgttgcaaaacatttacaggggcttgattatgaacttcgtctgacacaaggttca
tacccttttaaaacagatacagatacaaaactggtcaaaaagatagatgaagccataaaa
caggttacatgtaaagagccaaaacactctactgccggcggaactagcgatgcaagattc
atagcgcctcttggtgtagatgttatagaatttggtgtacgtaatgatacgattcactca
acaaatgagaggacaacaaaaaaagaggtagaagatttatatagagtttttagccgcctc
atagaaaactggaataaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system