KEGG   Sulfurimonas autotrophica: Saut_0752Help
Entry
Saut_0752         CDS       T01316                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sua  Sulfurimonas autotrophica
Pathway
sua00300  Lysine biosynthesis
sua01100  Metabolic pathways
sua01120  Microbial metabolism in diverse environments
sua01230  Biosynthesis of amino acids
Module
sua_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Saut_0752
Enzymes [BR:sua01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Saut_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ADN08801
UniProt: E0UQS0
Position
736754..737854
Genome map
AA seq 366 aa AA seqDB search
MDVIQLFKYLINSKSETPDDGGILNFVEDYLEGFKAVRIDVEDVKNLFIYKKFGDGEHLC
FAGHVDVVPAGDGWDTNPYEAVEKDGFIYGRGTQDMKSGVAAFTQAVKEAKNFQGTLSLI
LTSDEEGEATAGTVKALEYLQQHNMLPDACVVAEPTCEDKFGDAIKVGRRGSINGYLTVK
GKQGHAAYPEKAINPIHQIAQVLGDMAGVDLDEGDEFFAPSKFVITDIRSGMQVTNVTPN
ELQMMFNVRNNTKTTQKEVREFVAKHLQGLDYELRLTQGSYPFKTDTDTKLVKKIDEAIK
QVTCKEPKHSTAGGTSDARFIAPLGVDVIEFGVRNDTIHSTNERTTKKEVEDLYRVFSRL
IENWNK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtggatgttattcaactttttaaatatctgataaattcaaaaagtgaaacgcctgatgat
ggcggtattttgaactttgtagaagattaccttgaaggctttaaagcagttagaattgat
gtagaagatgtgaaaaatctttttatttataaaaaatttggtgatggagaacatttatgc
tttgcagggcatgttgatgttgttcccgcaggagatggctgggataccaatccgtatgag
gctgtagaaaaagatggctttatctatggacgtggcacacaggacatgaaaagcggtgtt
gctgcatttacacaggctgtaaaagaagcaaaaaactttcaaggcacactctctttgatc
ttaacatcagatgaagagggtgaggcaacagcaggcaccgtaaaagcattagagtattta
cagcaacataatatgcttcccgatgcctgtgttgttgccgagcctacatgtgaagataaa
tttggagatgccataaaagttggacgtcgaggctctattaacgggtatcttacagttaaa
ggcaagcagggacatgctgcataccctgagaaggcaataaacccaatacaccaaatagca
caagtattgggtgatatggcgggcgttgatttagatgagggtgacgagttttttgctcct
tcaaagtttgtcattacagatatacgttcagggatgcaggtgacaaatgtaaccccaaat
gaacttcaaatgatgtttaatgtcagaaacaatacaaaaacaacgcaaaaagaggttcgt
gaatttgttgcaaaacatttacaggggcttgattatgaacttcgtctgacacaaggttca
tacccttttaaaacagatacagatacaaaactggtcaaaaagatagatgaagccataaaa
caggttacatgtaaagagccaaaacactctactgccggcggaactagcgatgcaagattc
atagcgcctcttggtgtagatgttatagaatttggtgtacgtaatgatacgattcactca
acaaatgagaggacaacaaaaaaagaggtagaagatttatatagagtttttagccgcctc
atagaaaactggaataaataa

DBGET integrated database retrieval system