KEGG   Sulfurimonas autotrophica: Saut_0814Help
Entry
Saut_0814         CDS       T01316                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saut_0814
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saut_0814
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Saut_0814
Enzymes [BR:sua01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Saut_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
798716..800188
Genome map
AA seq 490 aa AA seqDB search
MNFIQTRGVDENRPQTVTFSQAILSPIASFGGLYVPQMLPELGEEFLQKHLNSSYKELAS
DMLSCFEIDIDAKVIEEALSLYDKFDDASNPVPVVKVKENLYISELYHGPTRAFKDMALQ
PFGVVLSSIAQRLNENYLILAATSGDTGPAALETFKNRANVKVACLYPDGGTSDVQRLQM
VTEDAPNLKVIGINGVFDDAQNALKRLLASQSFKEALQKKDTKLSAANSVNFGRIIFQII
YHIHSYLELVRQNAITMGEQVYLNVPSGNFGNALGGYYAWKMGVPVEKIIISSNENNVLT
RLIRNGKYDLRNCEVVGTTSPAMDILKSSNVERVLFDLFGEVRTKELMQNLEENNFYELT
ADELAKLRECFDADYCSGEEGKKYIKETFQKYHYLMDPHTATCMKSYETCSNPEIKTIAY
STAEWTKFSPVIANALTGEVDTKDIEALESISKVANLEIPQMIKELFSKPIAQTTVIEKE
NIEDEILKFL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaactttattcaaacacgcggcgtagatgaaaatagaccgcaaactgtaactttttca
caggcaatactgagccctatcgcatcttttggcggtctttacgttccccagatgcttccc
gagctaggagaagaatttttacaaaagcatttaaactcttcttataaagaactggcatct
gatatgttaagctgttttgagattgacattgatgcgaaagttattgaggaagcgttatct
ttatatgataaatttgatgatgcttctaatcctgtccctgttgtaaaagtaaaagaaaat
ctttatataagcgaactctatcatggccctacgcgtgcgtttaaagacatggctctgcag
ccctttggtgtagtactctcttcaattgcccaaagattaaatgaaaactatttgattttg
gcagcgacaagcggtgataccggtccggcagcgcttgaaacatttaaaaatcgtgcaaat
gtaaaagtggcatgtttatatcctgatggcgggacaagtgatgtacagcgtttgcaaatg
gttacagaagatgcgcctaacttaaaagtaatcggaattaacggtgtatttgatgatgca
caaaatgcactcaaacgtttgttggcttcacaaagttttaaagaagcacttcaaaagaaa
gatacaaaactctcagcagcaaactctgtcaactttggacgtattatatttcaaattatt
tatcacattcactcttatttggaactggttcgacaaaatgcaattactatgggcgaacaa
gtttaccttaatgttcctagtggaaactttggaaatgctcttggcggatattacgcttgg
aaaatgggagttcctgttgaaaaaatcattatttcatccaatgaaaataatgtacttaca
cgtttaattcgtaatggaaagtacgacttaagaaattgtgaagtagtgggcacaacatca
cctgcaatggatattttaaaatcatctaatgttgagcgtgtattatttgatttgttcggt
gaagtaagaacaaaagagttgatgcagaatcttgaagagaataatttctatgaattaact
gctgatgagcttgcaaaactccgtgagtgttttgatgctgactattgcagcggtgaagag
ggaaaaaaatatattaaagaaacattccaaaagtatcactatttgatggatccgcatacg
gctacatgtatgaagtcatatgaaacatgctcaaaccctgaaatcaaaacgattgcctat
tcaactgccgagtggacaaaattttctcctgtgattgcaaatgcattaacgggagaagta
gatacaaaagatattgaagcattggaatctatatctaaagtggcaaatcttgaaattcct
cagatgataaaagaactcttttctaaaccaatagcacaaacaacagtgatagaaaaagag
aatatagaagatgagatactgaagtttttataa

DBGET integrated database retrieval system