KEGG   Sulfurimonas autotrophica: Saut_0814Help
Entry
Saut_0814         CDS       T01316                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saut_0814
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saut_0814
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Saut_0814
Enzymes [BR:sua01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Saut_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
798716..800188
Genome map
AA seq 490 aa AA seqDB search
MNFIQTRGVDENRPQTVTFSQAILSPIASFGGLYVPQMLPELGEEFLQKHLNSSYKELAS
DMLSCFEIDIDAKVIEEALSLYDKFDDASNPVPVVKVKENLYISELYHGPTRAFKDMALQ
PFGVVLSSIAQRLNENYLILAATSGDTGPAALETFKNRANVKVACLYPDGGTSDVQRLQM
VTEDAPNLKVIGINGVFDDAQNALKRLLASQSFKEALQKKDTKLSAANSVNFGRIIFQII
YHIHSYLELVRQNAITMGEQVYLNVPSGNFGNALGGYYAWKMGVPVEKIIISSNENNVLT
RLIRNGKYDLRNCEVVGTTSPAMDILKSSNVERVLFDLFGEVRTKELMQNLEENNFYELT
ADELAKLRECFDADYCSGEEGKKYIKETFQKYHYLMDPHTATCMKSYETCSNPEIKTIAY
STAEWTKFSPVIANALTGEVDTKDIEALESISKVANLEIPQMIKELFSKPIAQTTVIEKE
NIEDEILKFL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaactttattcaaacacgcggcgtagatgaaaatagaccgcaaactgtaactttttca
caggcaatactgagccctatcgcatcttttggcggtctttacgttccccagatgcttccc
gagctaggagaagaatttttacaaaagcatttaaactcttcttataaagaactggcatct
gatatgttaagctgttttgagattgacattgatgcgaaagttattgaggaagcgttatct
ttatatgataaatttgatgatgcttctaatcctgtccctgttgtaaaagtaaaagaaaat
ctttatataagcgaactctatcatggccctacgcgtgcgtttaaagacatggctctgcag
ccctttggtgtagtactctcttcaattgcccaaagattaaatgaaaactatttgattttg
gcagcgacaagcggtgataccggtccggcagcgcttgaaacatttaaaaatcgtgcaaat
gtaaaagtggcatgtttatatcctgatggcgggacaagtgatgtacagcgtttgcaaatg
gttacagaagatgcgcctaacttaaaagtaatcggaattaacggtgtatttgatgatgca
caaaatgcactcaaacgtttgttggcttcacaaagttttaaagaagcacttcaaaagaaa
gatacaaaactctcagcagcaaactctgtcaactttggacgtattatatttcaaattatt
tatcacattcactcttatttggaactggttcgacaaaatgcaattactatgggcgaacaa
gtttaccttaatgttcctagtggaaactttggaaatgctcttggcggatattacgcttgg
aaaatgggagttcctgttgaaaaaatcattatttcatccaatgaaaataatgtacttaca
cgtttaattcgtaatggaaagtacgacttaagaaattgtgaagtagtgggcacaacatca
cctgcaatggatattttaaaatcatctaatgttgagcgtgtattatttgatttgttcggt
gaagtaagaacaaaagagttgatgcagaatcttgaagagaataatttctatgaattaact
gctgatgagcttgcaaaactccgtgagtgttttgatgctgactattgcagcggtgaagag
ggaaaaaaatatattaaagaaacattccaaaagtatcactatttgatggatccgcatacg
gctacatgtatgaagtcatatgaaacatgctcaaaccctgaaatcaaaacgattgcctat
tcaactgccgagtggacaaaattttctcctgtgattgcaaatgcattaacgggagaagta
gatacaaaagatattgaagcattggaatctatatctaaagtggcaaatcttgaaattcct
cagatgataaaagaactcttttctaaaccaatagcacaaacaacagtgatagaaaaagag
aatatagaagatgagatactgaagtttttataa

DBGET integrated database retrieval system