KEGG   Sulfurimonas autotrophica: Saut_0966Help
Entry
Saut_0966         CDS       T01316                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sua  Sulfurimonas autotrophica
Brite
Enzymes [BR:sua01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Saut_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(945851..946864)
Genome map
AA seq 337 aa AA seqDB search
MKKIVALTLTAASLMASSLVQDAKNAGLAPIPTEASKLLKLIDNPKNPITKAKVELGKKL
YFDPRLSKSGLISCNTCHNLSKGGDDGMQAAVGHKWTANPHHLSSPTVYNAVFNDKQFWD
GRSPDVEDQAQGPIQAAPEMAATQEHVVAVVTSMPAYVKEFQKAYGKNVKITFKKVADTI
GLFERTLVTPAPFDAFMNGDENAMTKKQKEGLKTFIQVGCASCHNGVGIGGGMNAFNVVA
KYKYMNVGDFKGDANGMVKVPTLRNVTQTAPYFHNGMIPTLKDAIKEMGRIQLGANISDK
QAKSIEAFLGALDGKKPYVKLPMLPATNDNTPKPELN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcgtagctctaacacttacagcggcttcactcatggcaagctcattggtt
caagatgcaaaaaatgcaggacttgcaccaattccaacagaagcaagtaaactgttaaaa
ttaattgacaatccaaaaaaccctattacaaaagctaaagtagaacttggtaaaaaactt
tactttgacccgagactttccaaaagtggtcttatctcttgtaatacttgtcacaaccta
agcaaaggcggcgatgacggtatgcaggcggcagtcggtcacaaatggacagctaacccg
catcacctgagctctccgactgtatataatgcagtgtttaatgacaaacagttttgggat
ggtagaagtccagacgtagaagatcaggctcaaggtcctatccaagcggctcctgaaatg
gctgctacacaagagcatgtcgttgcagtagtaacttctatgcctgcatatgtgaaagaa
tttcaaaaagcatacggcaaaaatgtaaaaatcacatttaaaaaagtggctgacactatc
gggttgtttgagagaacacttgtaacacctgctccttttgacgcatttatgaacggcgat
gaaaatgccatgacgaaaaagcaaaaagaaggtttaaaaactttcattcaagttggttgt
gcatcatgtcataacggtgttggtattggcggtggaatgaatgcctttaatgtagttgca
aaatacaaatatatgaacgtaggggactttaaaggggatgccaacggtatggtaaaagtt
ccgacacttagaaatgtaacccaaactgctccatactttcacaacggtatgataccaaca
ctcaaagatgcaatcaaagagatgggtcgcattcaacttggagctaacatcagtgacaag
caggctaaatctatagaagcatttttaggtgcacttgatggtaaaaaaccatatgtgaaa
ttgccaatgcttccagctacaaatgacaatactcctaaaccggagttaaactaa

DBGET integrated database retrieval system