KEGG   Sulfurimonas autotrophica: Saut_1116Help
Entry
Saut_1116         CDS       T01316                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sua  Sulfurimonas autotrophica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saut_1116
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Saut_1116
   00640 Propanoate metabolism
    Saut_1116
   00660 C5-Branched dibasic acid metabolism
    Saut_1116
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saut_1116
Enzymes [BR:sua01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Saut_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1113709..1114884
Genome map
AA seq 391 aa AA seqDB search
MNIHEYQAKQIFAQYGVPTPRGMVANTPDEAVKAAHELGGNIWVVKAQIHAGGRGLGGGV
KLAKSIEEVKELAGEILGMTLVTHQTGPEGKLVQKVYIEEGADIKDELYLSVVLDRAQEM
PIIMASTEGGMDIETVAEKTPEKIIKVTIDPSIGFQGFHGRELVFGLGITDKNEQRKMID
FASKLYKVYMDKDAEMIEINPLIKTGAGDFIALDGKMGFDDSALGRHPELEDMRDISEED
PDEREASQYGLSYIALDGEIGCMVNGAGLAMGTMDTINYMGGTPANFLDVGGSANAETVA
KGFEIILKNPNVKAIFVNIFGGIVRCDRIANGILEATKLVDVHVPVIVRLDGTNAPEAAE
ILKNANIANVIAATDLADGAAKAVAAAKGEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacatgaatatcaggcaaaacagatttttgctcagtatggtgttccaacacct
agaggtatggtggcaaacacaccagatgaagcagtaaaagctgcacatgaattaggtgga
aacatttgggtagtaaaagcacaaatacatgctggaggacgcggacttggcggtggtgtt
aagcttgcaaaatctatagaagaagtaaaagagttagcaggcgaaatcttaggaatgaca
cttgtaactcaccaaacaggaccagaaggtaaacttgtacaaaaagtttatatagaagag
ggtgcagatattaaagatgagttatatctttctgtagtacttgaccgtgcacaagagatg
cctattattatggcttcaactgaaggcggtatggatattgaaactgttgcggaaaaaact
ccggaaaaaatcattaaagtgactattgatccttctattggatttcagggatttcacggt
cgtgaattagtttttggtcttggaattacagataaaaacgaacaacgtaaaatgattgat
tttgcttctaaactttataaagtttatatggataaagatgcagaaatgattgaaatcaat
ccattgattaaaaccggagcaggggattttattgcactagacggtaaaatgggatttgat
gattcagctcttgggcgtcatcctgaactcgaagatatgcgagatatatctgaagaagac
ccggatgaaagagaagcgagtcaatatggtctttcttacatcgctcttgatggtgagatt
ggttgtatggtaaatggtgccggccttgcgatgggtactatggatactattaactatatg
ggtggaacacctgcaaacttccttgatgttggtggttcagcaaatgctgagacagttgcg
aaaggttttgaaattattttgaaaaacccaaatgtaaaagctatttttgtaaatattttc
ggtggtattgtacgttgtgaccgtattgcaaacggaattttggaagctacaaaacttgta
gatgttcatgttcctgttattgttcgtcttgatggtacaaatgcaccagaagcagcagaa
attcttaaaaatgcaaatattgctaatgttattgctgcaacagatttagcagacggtgct
gcaaaagcagtagctgcagcaaaaggagagttataa

DBGET integrated database retrieval system