KEGG   Sulfurimonas autotrophica: Saut_1232Help
Entry
Saut_1232         CDS       T01316                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saut_1232
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saut_1232
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Saut_1232
Enzymes [BR:sua01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Saut_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1206340..1207539
Genome map
AA seq 399 aa AA seqDB search
MYIPTPSKYDPDENGHFGIFGGRYVPETLMPALLQLKEEYEAIRFNEDFWKEVDYYLKDY
VGRPSPLFYAENISKEIGAKVYLKREDLNHTGAHKINNVIAQGLMAKRLGYKKVIAETGA
GQHGVATATIAALLGLECEIFMGAKDVERQELNVFRMKLLGAKVNSVASGSKTLKDAMND
AIRHWVTNARDTFYIIGTVAGPHPYPMMVRDFQAIIGWEARAQILEKENRLPDYVIACIG
GGSNAIGTFQHFLEDKEVQCIGIEAGGLGIETNKHGCSLEKGRPGVLHGQMSYLLQDEDG
QVLEAHSISAGLDYPGIGPEHAFHKDNKSVSYDNVTDQEALDAFVWLSQKEGIIPAFESS
HAVAYLKKMKNIEGKLIIVNLSGRGDKDMIQAKNILHFD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtatattcccactccttcaaagtatgatcctgatgaaaatggacattttggaattttc
ggcggtcgttatgttcctgaaacactcatgccggcactgcttcaactcaaagaagagtat
gaagctattcggtttaatgaagatttttggaaagaagtagactactatttgaaagattac
gtaggtcgtccgagtcctctcttttatgccgaaaatatttccaaagaaatcggtgcaaag
gtttacctcaaacgtgaagatttaaatcataccggcgcacataaaataaataatgtaatc
gcacagggattaatggcaaaaaggttaggttacaagaaggtcatagcagaaacaggtgca
ggacaacatggggtcgcaactgcaactatagccgcacttcttggcttagaatgtgaaata
tttatgggtgcaaaagatgtagagagacaagaactcaatgtgtttcgcatgaaactttta
ggtgcaaaagtaaacagtgttgcaagcggcagtaaaacattaaaagatgccatgaatgat
gccatccgccactgggttacaaatgcaagagatactttttacattatcggaacggttgca
ggtccacacccctatcctatgatggtacgagattttcaggcaattatcggctgggaagca
agagcgcagattttggaaaaagaaaatagattaccggattatgttatagcctgcataggc
ggcggtagtaatgctataggtacatttcaacactttttagaagataaagaggtacaatgt
attggcatcgaagccggtggcctaggtattgaaacgaacaagcatggctgctctttagaa
aaaggacgtccgggtgttttgcatggtcaaatgagttatttacttcaagatgaagacgga
caggttcttgaagcgcattctatcagtgcggggcttgactacccgggtattggacccgaa
catgcttttcataaagacaataaatcagtttcatatgacaatgtaactgaccaagaagct
ttggatgcttttgtgtggctttctcaaaaagagggaataattcctgcatttgaaagttct
catgccgtagcatacttgaaaaaaatgaaaaacattgagggaaaactcatcatagtcaat
ttatcaggccgtggtgataaagatatgattcaggctaaaaatattctacactttgattaa

DBGET integrated database retrieval system