KEGG   Sulfurimonas autotrophica: Saut_1409Help
Entry
Saut_1409         CDS       T01316                                 

Definition
phospholipase A(2) (EC:3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sua00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:sua00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:sua00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1389635..1390531)
Genome map
AA seq 298 aa AA seqDB search
MKFFVILTILAVYIFAADNMLTTVDESKSKIEIKNITNDKSKESMEQWINAEFGLQPYRT
NYLLPFGIANRTYLSHSPGENFKDKEAEIQVSLKLRVANNLFGLNEKYYLSYTHHAFWQI
YTQSAPFRESLYNPEAFVVFPISDKKSCMQMRSLKFAIAHKSNGQPNTKDNPAYNGFNLS
KSINYVYATLRLQHKTLISDLTFMTPYLGNSDLTDNPDIMKYMGYTKVKFTYFYDEHMFT
LMLRGNLDSQKGAVEATYSYPLYKSSYLYAKLFSGYMESLIDYNHYITKFSIGFSFSR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttttgtaatactgacaatacttgctgtatatatttttgcagcagataatatg
ttaacaacagttgatgaatcaaagagtaaaattgaaataaaaaatattaccaatgataaa
tcaaaagagagtatggaacagtggataaatgctgaatttggactgcagccgtataggaca
aattatttactgccttttggcattgcaaatagaacatatctatcgcatagtccgggagaa
aattttaaagataaagaagctgaaattcaagtaagtttaaagttaagagtagcaaataat
ctttttggtttgaatgaaaaatattatctctcttacacccatcatgccttttggcagatt
tatacacaatctgcaccttttcgcgagagcttgtataaccccgaagcatttgtagttttt
ccgatcagcgataaaaaatcatgtatgcaaatgcgctctttaaaatttgcaatagcgcac
aaatctaatggacagccaaatactaaagataatcctgcttataatggatttaatctttct
aaaagtataaactatgtctatgcaacacttcgcctgcagcataaaacacttattagtgat
ttgacatttatgacaccgtatttaggaaattccgatttgacggataatcccgatattatg
aaatatatgggatatacaaaggtaaaatttacatatttttatgatgagcatatgtttaca
ttgatgcttcgcggcaatcttgacagtcaaaaaggtgcggtagaagcaacatactcttat
cctttatacaagagctcttatctctacgcaaaactgtttagcgggtatatggaatcattg
attgattacaatcattatattacaaaattttcaataggatttagcttctctcgttaa

DBGET integrated database retrieval system