KEGG   Sulfurimonas autotrophica: Saut_1410Help
Entry
Saut_1410         CDS       T01316                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sua  Sulfurimonas autotrophica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sua00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Saut_1410
DNA repair and recombination proteins [BR:sua03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Saut_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1390532..1391101)
Genome map
AA seq 189 aa AA seqDB search
MNNSLEKFNRLVEALGELPSIGKKSATRLAYYMIMNDTFAGMKIAHAIEDALGSLKKCKE
CGGMSEDELCYICCDEMRDASLLCIVENAKDILLLEENGLFDGKYFVLESLEELSMSHLE
TIVQNGVSEVLFALTPSIANDAVILYIEDKLGIYDLNFSKIAQGVPTGVSLENIDLLSLT
RALEDRVRV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaataattcattagaaaaatttaacagactcgtagaagcgcttggtgaactgccgagt
atcggaaaaaaatcggcaacaagacttgcttattacatgattatgaatgatacttttgcc
ggtatgaaaattgcacatgcaattgaagatgcccttggaagcttgaaaaaatgtaaagag
tgtggtggaatgagtgaagatgagctttgttatatctgttgtgatgaaatgagggatgct
tctttattatgtatagttgaaaatgctaaagatattttgctattagaagaaaatggcttg
tttgacggtaaatactttgtcttagagtctctagaagagttaagtatgtcacatcttgaa
acaattgttcaaaatggagtaagtgaggtgttatttgcactcactccttccatagctaat
gatgcggtaatactctatatcgaagataaacttggtatttatgatttgaatttttctaaa
atagcgcaaggtgttccaacaggtgtaagtttggaaaatatagatttactttcactaacg
agagcattagaagatagagtaagggtgtag

DBGET integrated database retrieval system