KEGG   Sulfurimonas autotrophica: Saut_1413Help
Entry
Saut_1413         CDS       T01316                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sua  Sulfurimonas autotrophica
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sua00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1393416..1394006
Genome map
AA seq 196 aa AA seqDB search
MNKARLKNQLSSLALSMFRKDFFGIYHGSLSAKTDKSRFIINTKEAVFDDIDENSLIELY
FKKDYRWKQASIDADIHQSIYSHISEAKFACFSMPQFTTAYSLEHNMIIPKDYFGYTEIG
SIEIVDPKQFEDWYDRAQSEIVLYFQTKKTNIMVIRGYGVYAYSRDMHEMAKKLAILEKS
CRLLMLSDSANLCDFD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcgcgcttaaaaaatcaactctcttcactggctctttccatgtttagaaag
gattttttcggtatttaccacggctctttatctgccaaaacagataaaagccgctttatc
ataaatacaaaagaagctgtttttgatgatatagatgaaaatagtcttatagagttgtat
tttaaaaaagattacagatggaaacaggccagtattgacgcagacattcatcaaagtatc
tattcgcatatttcagaagcaaaattcgcatgttttagtatgccgcagtttactacggca
tactctctggaacataatatgataatcccaaaggattacttcggatatacagaaataggt
tcaatcgaaatagttgaccccaaacagtttgaagactggtatgacagagcgcaaagtgaa
atagtactctactttcaaacaaaaaaaacaaatattatggtgattcgcggttatggagtt
tatgcatacagcagagatatgcatgaaatggcaaaaaaacttgccattctagaaaaaagc
tgccgcttgcttatgctgagtgattcagcaaacctctgtgattttgattag

DBGET integrated database retrieval system