KEGG   Sulfurimonas autotrophica: Saut_1471Help
Entry
Saut_1471         CDS       T01316                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saut_1471
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_1471
   00620 Pyruvate metabolism
    Saut_1471
   00640 Propanoate metabolism
    Saut_1471
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saut_1471
   00680 Methane metabolism
    Saut_1471
Enzymes [BR:sua01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Saut_1471
Lipid biosynthesis proteins [BR:sua01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Saut_1471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1453341..1455305)
Genome map
AA seq 654 aa AA seqDB search
MSAIEKKPVFKPNKEFAKTARIKNMCEYQDLQDEATEDYEGFWGRFAKEKLDWIEPFTNV
MDESKFPFVKWFEGGKLNVSAQCIDRHLDTRKNKAAIIFEGDRGDKQIVTYLELYYNVNR
FANLLKNEFGVKKGDRVVIYMPMIPEAAYAMLACARIGAIHSIVFGGFSAEALKDRIEDA
DAKVVITADGAYRKDKPYMLKPVVDAALEGDTPVKKVLVVERNNEDITWVAGRDYSYNEL
IKSQEVHCEPEVMDSEDPLFLLYTSGSTGKPKGVQHNSAGYILWAQMTMEWVFDVKENDT
YWCTADVGWITGHTYIVYGPLAMGATTVMFEGVPTYPDAGRPWKMVEEYKINQFYTAPTA
IRVLHKMGENEPAKYDLSSLKVLGTVGEPIDPPAWKWYYEEVGNSKCAIVDTYWQTETGG
HIVSPLPGATPIKPACATFPVPGIMAEVLDPETGEKVGAGESGYMCVTRPWPSMIRGVWG
DEERFVKSYFGDVKKDGKPVYFTGDGANYDEDGYITITGRTDDVINVSGHRMGTAEVEAA
IKKHSNVAEVAVVGKPHELKGEGIFAYVVLKSDKGVADEVEEVKAINNIIKKEIGNIAIC
DDMVFAPGLPKTRSGKIMRRILRSIAKGESITQDISTLEDPSIVEKIENMVKSK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaatagagaaaaaaccggtttttaagccaaataaagagtttgcaaaaactgct
agaattaaaaatatgtgtgaatatcaagatttacaggatgaagctactgaagactatgaa
ggtttttggggcagatttgctaaagaaaagcttgactggatagaaccatttaccaatgtt
atggatgaatcaaaatttccttttgtaaaatggtttgagggcggaaaacttaatgtgtca
gcacaatgtattgaccgtcatttagatacacgtaaaaataaagctgcgattatctttgaa
ggagatcgtggagataagcagatagttacatacttggaactttactataatgtaaaccgt
tttgcgaatttgctaaaaaatgaatttggtgttaaaaaaggcgacagagttgttatttat
atgccgatgattcccgaagccgcgtatgcaatgcttgcatgtgccagaatcggggctatt
cactctatagtatttggcggattttctgctgaagcattgaaagacagaattgaagatgct
gatgcaaaagtggtaattacggcagacggtgcttatagaaaagataagccgtatatgctt
aaacctgttgttgatgctgctttagaaggcgatacaccggttaaaaaagttttagttgtt
gagagaaataatgaagatattacatgggttgcaggacgtgactactcatataatgagctt
ataaaatctcaagaggttcattgtgagccggaggttatggatagtgaagatcctctgttt
ttactttatacttcaggttcaacagggaaaccaaaaggtgtgcaacacaactctgcagga
tatatcctttgggctcaaatgactatggaatgggtatttgacgtaaaagagaatgatact
tactggtgtactgccgacgttggctggattacaggacatacgtacatagtttatggacca
cttgcaatgggtgcaacgactgtaatgtttgaaggggttccaacgtatcctgatgctggt
cgtccttggaaaatggttgaagagtataaaattaatcaattttatactgcacctactgct
attcgagtactgcataaaatgggtgaaaatgagccggctaaatatgaccttagcagctta
aaagtacttggaactgttggtgaaccgattgatccaccggcatggaaatggtactatgaa
gaagttggtaacagtaaatgtgctatcgttgatacatactggcagactgaaacaggtgga
catatagtttctccgcttccgggggctacacctattaaacctgcttgtgcaacattccct
gttcctggaattatggcagaggttttagatcctgagacaggtgaaaaagtaggagccggt
gagagcggttacatgtgtgtaacgcgtccttggccttcaatgatccgcggtgtctggggc
gatgaagagagatttgtgaaatcttacttcggtgatgtaaaaaaagacggtaaacctgtg
tattttacaggggacggtgcaaattatgatgaagacggatatattactattacaggtcga
acggatgatgttattaacgtaagtggacatagaatgggaactgctgaagttgaagcggct
attaaaaaacattcaaatgttgccgaggttgccgttgtcggtaaaccgcatgaactcaaa
ggtgaaggtatattcgcttatgttgttcttaaatcagacaaaggtgttgccgatgaagta
gaagaggtaaaagcaattaataatatcattaaaaaagagataggaaatattgctatttgt
gatgatatggttttcgctcccggtcttccaaaaacccgttccggaaaaataatgcgccgt
attctacgctcaattgctaaaggcgaatcgattacacaagatatttcaacgcttgaagat
ccaagtatagttgaaaaaatagaaaatatggtaaagtctaaataa

DBGET integrated database retrieval system