KEGG   Sulfurimonas autotrophica: Saut_1512Help
Entry
Saut_1512         CDS       T01316                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sua  Sulfurimonas autotrophica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Saut_1512
   00052 Galactose metabolism
    Saut_1512
   00500 Starch and sucrose metabolism
    Saut_1512
   00520 Amino sugar and nucleotide sugar metabolism
    Saut_1512
Enzymes [BR:sua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Saut_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1495673..1496635)
Genome map
AA seq 320 aa AA seqDB search
MQRCIKKCLFPAAGYGTRFLPATKAIPKEMLPVLTKPLLQYGVEEAIEAGLSTMAIVTGR
GKRAIEDHFDISYELEHQIKDTAKESYLTEIRNVITNCTFSYTRQIEMKGLGHAILTGET
LIGEEPFAVILADDLCDNEAEGVLSQMVKLYEKYKCSIVAVEEVPLEETNKYGVVAVEEM
DISDEVQPMLKPGFREQDGNKVSTAQESITKLQNDIGSKVLTLPNIGVFKVTNMVEKPDP
KDAPSNLAIIGRYILTPDIFDILRETKPGKGGEIQITDALLEQAKQGKVIAYKFQGKRFD
CGSVDGFVEATNYFYQKSEN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaagatgtataaaaaaatgtcttttccccgctgcaggctatggtacaagatttctt
ccggctactaaggccattcctaaagagatgcttcccgtactaactaaaccactgctacaa
tatggtgtagaagaggcaatagaagcaggactaagcacgatggcgatagtaacagggcgt
ggaaaacgtgctattgaagaccattttgacatctcttacgaacttgaacatcagataaaa
gacacagctaaagagagttatctgactgaaataagaaatgtcatcacaaactgtacattt
tcatacaccagacaaatagagatgaaagggctgggtcatgcaatacttacaggtgaaacg
ctcataggagaagagccgtttgccgttatacttgcagatgacttgtgtgataatgaagca
gagggcgttctctcccagatggtgaagctttatgaaaagtataaatgttccattgtggca
gtagaagaagtgcccttagaagagacgaacaaatatggggtggttgctgtagaagagatg
gatatttcagatgaagttcagcccatgttaaaacctgggttccgagagcaagacggaaac
aaagtttctactgcacaagaaagtataacaaagttacaaaatgatatcggaagcaaggtt
ttaaccttgcctaatataggggtttttaaagttacaaacatggtagaaaaaccagacccc
aaagatgctccttcaaacttggcaatcataggacgctatattctcacacctgatattttt
gatatattaagagagacaaaaccaggcaaaggcggagaaatccaaataacagacgcactg
ttagaacaagccaaacaaggaaaagttatcgcctataaatttcaaggcaaaagatttgac
tgcggcagtgtcgatggttttgttgaagctactaattatttttatcaaaagagtgagaac
taa

DBGET integrated database retrieval system