KEGG   Sulfurimonas autotrophica: Saut_1578Help
Entry
Saut_1578         CDS       T01316                                 

Definition
ATP citrate lyase subunit 1 (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
sua  Sulfurimonas autotrophica
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Class
Metabolism; Overview; Carbon metabolism [PATH:sua01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sua00020]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sua00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1574067..1575407)
Genome map
AA seq 446 aa AA seqDB search
MAQKAIREYDAKSILAKHWNKYFPDFSYAYETVLVTSGAELLEAAKEKPWLKEKPLVVKP
DMLFGKRGKNGLVLFKDQKPGDVTLEKAAAWIDEKAKEDQSVYFSFDGDTPTGEPKVDRL
THFIVEPFTPHDQSEEYYISATVVGDEDVLYLSAEGGMEVEEGWDEKVTELAFPITATEE
EIAEKIKANVPADVKPEDKENFAKFAIGFFKAYRKLNFAYLEINPFVMQGSKIELLDMVA
KLDDTAGFMMTEEWGDIEYPTAFGMEAKSPEVEAIEEADAKTGASLKLTLLKPDARIWTM
VAGGGASVVYADTIADFAGIEDLANYGEYSGGPTTGETKFYAETLLDLMTREKDPKGRDK
ILIIGGAIANFTDVAKTFTGIIQAFEEYADKMKEVGIKIYVRRGGPNYEKGLKDIKEAAD
KLGLSIEVYGPETHVTDIVRMALEEK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaagcgatacgagaatatgacgcgaagtcaattttagcaaaacattggaat
aaatactttccagatttcagttatgcatacgagacagttctagtaacatcaggtgctgaa
ttacttgaagctgcaaaagaaaaaccatggttaaaagaaaagccattagttgtaaaaccg
gatatgttatttggtaaacgcggtaaaaatggacttgtactttttaaagatcaaaagccg
ggtgatgttactttagaaaaagcagcagcatggattgatgaaaaagcaaaagaagatcag
tctgtatacttttcatttgatggggatactccgacaggtgagccaaaagtagatagatta
acacactttatcgttgagccgtttactccacatgaccaatcagaagagtattatatttct
gcaactgttgttggtgatgaagacgttctttatctatcagctgaaggtggtatggaagtt
gaagaaggttgggatgaaaaagttacagaattagcattcccaattacagcaactgaagaa
gaaatcgctgaaaaaatcaaagcaaatgtcccggctgatgttaaaccggaagacaaagaa
aactttgcgaaatttgcaatcggttttttcaaagcgtatcgtaaattaaacttcgcttac
cttgaaatcaatccatttgtaatgcaagggagtaaaatcgagctcttggatatggttgca
aaacttgatgatactgctggatttatgatgacagaggagtggggtgatattgaatatcct
actgcatttggtatggaagcaaaatctcctgaagttgaagcgattgaagaagcagatgca
aaaacaggtgcttcattaaaacttactcttttaaaaccagatgctagaatctggactatg
gttgccggtggtggtgcttcagttgtatatgctgatactattgctgactttgcaggtata
gaagatcttgccaattatggtgagtattcaggtggtccaactacaggtgaaacaaaattt
tatgcagaaactctacttgatttaatgactagagaaaaagaccctaaaggtcgagataaa
attttaattatcggtggagctattgcaaactttactgatgttgcaaaaacatttacaggt
attattcaggcttttgaagagtatgctgataaaatgaaagaagttggaattaaaatctac
gttcgtcgtggtggaccaaactatgaaaaaggtctaaaagatattaaagaagctgctgac
aaattaggtttaagtattgaagtttatggaccagaaacacatgttacagacatcgtgcgt
atggcactagaagaaaagtaa

DBGET integrated database retrieval system