KEGG   Sulfurimonas autotrophica: Saut_1597Help
Entry
Saut_1597         CDS       T01316                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saut_1597
   01230 Biosynthesis of amino acids
    Saut_1597
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_1597
   00030 Pentose phosphate pathway
    Saut_1597
   00051 Fructose and mannose metabolism
    Saut_1597
   00052 Galactose metabolism
    Saut_1597
  Energy metabolism
   00680 Methane metabolism
    Saut_1597
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Saut_1597
Enzymes [BR:sua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Saut_1597
Protein phosphatases and associated proteins [BR:sua01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Saut_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1590266..1591225
Genome map
AA seq 319 aa AA seqDB search
MKQNIAIICSGGDVSGMNPALKRFVEYSFEQNLTPYFVYDGYEGLIDNNIKKADYCDVAG
IINRGGTKTGSARSKRFMQKEYRTIAKQNLDNLHVTMLIVLGGDGSFKGLHEFYKEHKIK
FCGIPSTIDNDISGTDYCLGVDTALNMIKFSIDSIRDTASSFKRAFVIETMGNKCGYLAL
VSHLTSGSELCLIPEIPYNLNDYEEKFKREIKNGRRYFIAVVAEGIKQDSAEIAKWFEEK
IGIESRVNILGHLQRGGNPTVKDRLMAYKFITYAIDGLMKNKNESIICYMESGFEYKEID
AVVNTPYQLNHELIKYISS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaatattgcgattatttgttcaggcggtgatgtatcaggtatgaaccctgca
ttaaaacgatttgtcgaatacagttttgaacagaatcttacaccctactttgtatatgac
gggtatgagggactcattgacaacaatataaaaaaagcagattattgcgatgttgcaggt
attatcaatcgtggaggcacaaaaacagggagtgccagaagcaaaagatttatgcaaaaa
gaataccgaactattgcaaaacaaaatcttgataacttacatgtaactatgttaatagta
cttgggggtgatggctcttttaaaggattacatgaattttataaagaacataaaataaaa
ttttgtggtattccttcgactattgacaacgatatttccggtactgattattgcttaggt
gtggatacagcacttaatatgataaaattttcaatagattctataagagatacggcatcc
tcatttaaaagagcttttgtgattgagactatgggtaacaagtgcggttatctagcgctt
gtatcacatctaacatcaggttctgaactttgccttattccagagataccatataatttg
aatgattatgaagaaaaattcaaacgagaaataaaaaatggtcgtagatattttatagct
gtggttgcagaaggtataaaacaagattctgccgaaatagctaagtggtttgaagaaaaa
attggtattgagtcaagagtgaatattctaggacatttacagcgtggaggcaatccaaca
gtaaaagatagacttatggcttataaatttataacatatgccattgatggtttaatgaaa
aataaaaatgaaagtattatttgttatatggagagtggatttgaatataaagaaattgat
gcggtcgtgaacacgccgtatcaattaaatcatgagcttataaaatatataagctcataa

DBGET integrated database retrieval system