KEGG   Sulfurimonas autotrophica: Saut_1607Help
Entry
Saut_1607         CDS       T01316                                 

Definition
GTP-binding protein LepA
Orthology
K03596  
GTP-binding protein LepA
Organism
sua  Sulfurimonas autotrophica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1600355..1602145
Genome map
AA seq 596 aa AA seqDB search
MKNIRNFSIIAHIDHGKSTLADRIIQECGSVTEREMGTQMMDTMDIEQERGITIKAQSVR
LDYVKDGEHYILNLIDTPGHVDFSYEVSKSLASSDGALLIVDAAQGVEAQTIANVYLALD
NDLEIIPVINKIDLPAADPDKVAEEIETSIGIDATDAVLVSAKTGVGIRELIDAIVERVP
APQGNPEAPTKAIIYDSWFDQYLGALALVRVFDGEIKKNQTIKLMSNNEEHQVLDLMYPH
PLKKIKTPAIKSGEIGIVVLGLKEVSVVNVGDTITDAKNPTAEPVGNYEPAKPFVFAGLY
PIDTDKFEELRDALDKLKLNDSSLSYEPETSIALGFGFRVGFLGMLHMEVIKERLEREFG
LDLIATAPSVVYHVYLNNGDMIEVQNPSELPEVNHIDRIEEPYVKATVITPSEYLGNIMN
LLVSKRGIQNKMTYLNEDRVMLEYEIPMNEIVVDFYDTLKSISKGYASFDYEPTDFKEGD
LVKLDVKVAGEVVDALSVIVPRTSALSRGRTLVKNMKELIPRQLFEVAVQASLGNQVIAR
ETVKSMGKNVTAKCYGGDITRKRKLLEKQKAGKKRMKSIGKVQLPQEAFMSVLKMD
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatattagaaacttctcaatcattgcccacattgatcatgggaaaagtaccttg
gccgacagaatcatacaagagtgtggttcagttactgagcgagaaatgggcacgcaaatg
atggatactatggatatagaacaagaacgtggtattactattaaagcacagtcagttcga
cttgattatgtcaaagacggggaacattacattctcaatcttatagacacaccgggccat
gttgacttttcatatgaagtaagtaaatctttggcatcttctgatggagcattgctgatc
gttgatgctgcacagggtgtggaagcccaaactattgccaatgtttatctcgcgcttgac
aatgaccttgagatcattcctgttattaataaaattgacctcccagcagctgatcccgac
aaagtagctgaagaaatagaaacttccataggtatagatgctacagatgctgtactcgta
agcgcaaaaacaggtgtaggtatacgtgagctcattgacgcgattgtggaaagagtgcct
gcaccgcaaggtaatccagaggcaccaacaaaagcaatcatttatgattcttggtttgac
cagtaccttggtgccttggctcttgttcgtgtatttgatggagaaatcaaaaaaaatcaa
actatcaagctgatgtctaacaatgaagagcatcaagtacttgatttaatgtatccgcat
cctctgaaaaagattaaaacaccggctataaaaagcggtgaaattggtattgtagttctt
ggtctcaaagaagtaagcgttgtcaatgttggtgatactattaccgatgcgaaaaatcct
acagctgaaccggtaggtaattatgaacctgcaaaaccttttgtttttgcaggactttac
ccaatagatacagataaatttgaagagcttagagatgcacttgataaactcaagcttaat
gactcatcactctcttatgagcctgaaacttcaatagctctgggttttggttttcgtgta
ggatttcttggaatgcttcatatggaagttatcaaagaacgtctggagagagaatttgga
cttgatttaatcgctacagcaccctctgttgtttatcatgtctaccttaacaatggtgat
atgattgaagtacaaaacccttcagaactacccgaagtcaatcatatagacagaattgaa
gaaccgtatgtcaaagcaactgttattacaccaagtgaataccttggaaatattatgaat
cttttagtatcaaaacgtggtattcaaaacaaaatgacctatctcaacgaagacagggtt
atgcttgaatatgaaataccgatgaatgaaatcgtcgttgatttttatgatactcttaaa
tcaatttctaaagggtacgcttcttttgattatgaaccgacagactttaaagagggagac
cttgtaaaacttgatgtaaaagttgccggagaagtcgttgatgcactgagtgtcatagtg
ccaagaacttctgccctttcacgcggacggacactggtaaaaaacatgaaagagcttatt
ccccgccagctttttgaagtagccgttcaggcatcactgggtaatcaggtaattgctcgt
gaaactgtaaaatcaatggggaaaaatgtaactgccaaatgttacggcggagatattact
cgtaaacgtaaactactagagaagcaaaaagccggaaaaaaacgtatgaaatctatcggt
aaagtacaacttccgcaagaggcttttatgtccgttcttaagatggactaa

DBGET integrated database retrieval system