KEGG   Sulfurimonas autotrophica: Saut_1659Help
Entry
Saut_1659         CDS       T01316                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sua  Sulfurimonas autotrophica
Pathway
sua00240  Pyrimidine metabolism
sua00250  Alanine, aspartate and glutamate metabolism
sua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Saut_1659
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Saut_1659
Enzymes [BR:sua01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Saut_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADN09705
UniProt: E0UPH5
Position
complement(1650535..1651404)
Genome map
AA seq 289 aa AA seqDB search
MQHLIRTDDFTKEEIKELLADAKKFSDGRFERILQDKIIITLFFENSTRTKSSFEIAAKR
LGAEIVHLDVAKSSTKKGETLVDTAMNLDAMGPHAIVVRHENAGVPQILSKHTKASIVNA
GDGAHAHPSQALLDLYTLTEHFGSLEGKKIAIVGDIKNSRVANSNIELLTRFGMEVILVA
PPHFLPKTLLKTTHYLKEIIDDVDAIMSLRTQTERHSSQSYASLKDYASDFCITEELVGD
RDIILLHPGPVHRNIDISDAMLEDERCKVLEQVSNGVNIRMAILKKLIA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatttaataagaactgatgattttaccaaagaagagataaaagagttattggca
gatgccaaaaaattcagcgacggccgttttgaaagaattttacaagataaaattattatc
acgcttttttttgaaaactctacacgtacaaagagctcttttgaaattgccgcaaaaaga
ctcggtgccgaaatagtgcatcttgatgttgcaaaaagttctacaaaaaaaggagagaca
ctcgttgatacggcaatgaaccttgatgctatgggaccgcatgccatagttgtacgtcat
gaaaatgccggagtacctcaaattctttccaaacatacaaaggcaagcatagtcaatgct
ggtgacggtgcacatgcgcatccttctcaggcacttttagatttatatacacttacagag
catttcggatcacttgaaggtaagaaaattgccattgtgggagatattaaaaattcccgt
gttgcaaattcaaatatagagcttttaacacgttttggcatggaagttattttagtggca
ccgccgcatttcttaccaaaaacccttctgaaaactacacactatttaaaagaaattatt
gatgatgtagatgcgattatgagtctgcgtacgcaaacagaacgacactcatcacaaagt
tatgcttcactcaaagattatgcaagtgatttttgtataacagaagaacttgtgggtgat
cgagatattatactgctccatccaggaccagttcacagaaacatagatataagcgatgcc
atgctagaagatgagcgttgtaaagtattggaacaagtcagtaatggagtaaatataaga
atggcgatacttaaaaaactgattgcctaa

DBGET integrated database retrieval system