KEGG   Sulfurimonas autotrophica: Saut_1689Help
Entry
Saut_1689         CDS       T01316                                 

Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:sua01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sua01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sua00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sua00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sua00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:sua00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1679659..1680738)
Genome map
AA seq 359 aa AA seqDB search
MSNGVLDIVKPGVLFGDDVLKVYEHAKKVGFAIPAVNVVNTDSVNGVLEAAAKANSPVII
QFSNGGASYYAGKGLNNDGEKAAIVGAVAGAIHTHMMAEAYGVAVILHTDHASKKLLPWI
NALLEAGESYYKTQGKPLFSSHMLDLSEESLNENIGTCKAYLERMSKIGMSIEIELGCTG
GEEDGVDNTNIDNALLYTQPEEVALAYKELSEISSNFTIAASFGNVHGVYKPGNVQLTPK
ILDNSQKYIQEKFHTEEEPVNFVFHGGSGSLPSEISEAIGYGVVKMNIDTDTQWATWDGV
RKYVEKYHDYLQSQIGNPQGEDKPNKKYYDPRKWLRAGQENLVERVIQAYKDLNAMDRN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatggtgtattggatattgttaaacctggagttcttttcggtgatgatgtttta
aaggtatatgaacatgctaaaaaggtcggctttgccatacctgccgttaatgtggtaaat
acagactccgtcaacggtgttttagaagctgccgcaaaagctaattctcctgttattata
cagtttagtaacggcggtgcttcttattatgcagggaaaggtttgaataatgacggtgaa
aaagcggcgattgtcggtgctgttgccggtgcgattcatacacatatgatggcagaagca
tacggtgttgccgttattttacatacggatcatgcatcgaagaaactgcttccatggata
aatgctctgcttgaagcaggtgagagttattataaaacacagggtaaaccgcttttttct
tctcacatgcttgacctctccgaagagtctttaaatgaaaatattggtacatgtaaggct
tatttggagagaatgagtaaaatcggtatgagtattgagatagaactcggctgtacaggc
ggagaagaagacggtgttgacaatacgaacattgacaatgctcttttatacacgcagcca
gaagaagtcgcactcgcgtataaagaattgagtgaaatttcttcaaactttactatagca
gcttcgtttggaaacgtgcacggtgtttataaaccgggtaatgtacagttgacgcctaaa
attttagataattcacaaaaatatattcaagagaaattccatacagaagaagaacctgta
aattttgtatttcacggtggttcagggtcacttccttctgaaataagcgaagccatcggg
tacggtgttgtgaaaatgaatatagataccgatactcaatgggcaacatgggacggtgtt
cgcaaatatgtagaaaaatatcacgattatcttcaaagccaaatcggaaacccccaaggc
gaagataaaccgaataaaaaatattatgatcctagaaaatggcttcgtgcaggtcaagag
aacttggtcgagcgtgtgattcaagcctataaagacttaaatgcgatggatagaaactaa

DBGET integrated database retrieval system