KEGG   Sulfurimonas autotrophica: Saut_1689Help
Entry
Saut_1689         CDS       T01316                                 

Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saut_1689
   01230 Biosynthesis of amino acids
    Saut_1689
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_1689
   00030 Pentose phosphate pathway
    Saut_1689
   00051 Fructose and mannose metabolism
    Saut_1689
  Energy metabolism
   00680 Methane metabolism
    Saut_1689
Enzymes [BR:sua01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Saut_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1679659..1680738)
Genome map
AA seq 359 aa AA seqDB search
MSNGVLDIVKPGVLFGDDVLKVYEHAKKVGFAIPAVNVVNTDSVNGVLEAAAKANSPVII
QFSNGGASYYAGKGLNNDGEKAAIVGAVAGAIHTHMMAEAYGVAVILHTDHASKKLLPWI
NALLEAGESYYKTQGKPLFSSHMLDLSEESLNENIGTCKAYLERMSKIGMSIEIELGCTG
GEEDGVDNTNIDNALLYTQPEEVALAYKELSEISSNFTIAASFGNVHGVYKPGNVQLTPK
ILDNSQKYIQEKFHTEEEPVNFVFHGGSGSLPSEISEAIGYGVVKMNIDTDTQWATWDGV
RKYVEKYHDYLQSQIGNPQGEDKPNKKYYDPRKWLRAGQENLVERVIQAYKDLNAMDRN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatggtgtattggatattgttaaacctggagttcttttcggtgatgatgtttta
aaggtatatgaacatgctaaaaaggtcggctttgccatacctgccgttaatgtggtaaat
acagactccgtcaacggtgttttagaagctgccgcaaaagctaattctcctgttattata
cagtttagtaacggcggtgcttcttattatgcagggaaaggtttgaataatgacggtgaa
aaagcggcgattgtcggtgctgttgccggtgcgattcatacacatatgatggcagaagca
tacggtgttgccgttattttacatacggatcatgcatcgaagaaactgcttccatggata
aatgctctgcttgaagcaggtgagagttattataaaacacagggtaaaccgcttttttct
tctcacatgcttgacctctccgaagagtctttaaatgaaaatattggtacatgtaaggct
tatttggagagaatgagtaaaatcggtatgagtattgagatagaactcggctgtacaggc
ggagaagaagacggtgttgacaatacgaacattgacaatgctcttttatacacgcagcca
gaagaagtcgcactcgcgtataaagaattgagtgaaatttcttcaaactttactatagca
gcttcgtttggaaacgtgcacggtgtttataaaccgggtaatgtacagttgacgcctaaa
attttagataattcacaaaaatatattcaagagaaattccatacagaagaagaacctgta
aattttgtatttcacggtggttcagggtcacttccttctgaaataagcgaagccatcggg
tacggtgttgtgaaaatgaatatagataccgatactcaatgggcaacatgggacggtgtt
cgcaaatatgtagaaaaatatcacgattatcttcaaagccaaatcggaaacccccaaggc
gaagataaaccgaataaaaaatattatgatcctagaaaatggcttcgtgcaggtcaagag
aacttggtcgagcgtgtgattcaagcctataaagacttaaatgcgatggatagaaactaa

DBGET integrated database retrieval system