KEGG   Sulfurimonas autotrophica: Saut_1706Help
Entry
Saut_1706         CDS       T01316                                 

Definition
Sec-independent protein translocase TatC
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
sua  Sulfurimonas autotrophica
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:sua03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:sua03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1693178..1694029
Genome map
AA seq 283 aa AA seqDB search
MFDELRPHLVELRKRLAISAASLIVMFFVMFYFHEPILTWMVQPLNDALTEVGKVSVNAA
NGMITTSQVGGAFFVALKVSFFAAILGALPIILSQIWFFIAPGLYAHEKKMVFPFVAGGT
IMFLVGVLFAYYVVTPFGFDFLITFGSFKFTPLINIEDYVGFFTKIMFGFGLAFELPVFA
YFLALLGLVDDRQMTSFFKYAIVIIFIVAALLTPPDVLTQLLMAGPLVILYLLSILIVKM
VNPAAPIEDEENEDEDEEEDENNLKVEHHEDYDELVDDGKKGE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaattaagaccacaccttgtagaactccgaaaaaggctggctatatcagct
gcaagtttaatagtcatgttttttgtcatgttttactttcatgaacctatacttacatgg
atggtgcaaccactcaatgatgcacttacagaagttggtaaagtgtcagttaatgcggca
aacggtatgatcaccacctctcaagtcggcggtgcattttttgtagcattaaaagtttca
ttttttgcggccatattaggtgcactaccaattatactctcgcaaatttggtttttcatt
gctcctggtctttatgcgcatgaaaaaaaaatggtttttccttttgttgcaggaggaaca
atcatgtttcttgtgggtgtcctctttgcctactatgtcgtaacaccttttggatttgat
tttctcataacctttggttcttttaaattcaccccgcttattaatattgaagattatgta
gggttttttacaaaaatcatgtttggttttggtcttgcttttgaactgcctgtttttgcc
tactttttagcacttcttggtcttgttgatgacagacaaatgacatcatttttcaaatat
gccattgttattatttttattgttgcggcacttttaactccaccggatgtacttacacaa
cttctgatggcaggtccgcttgttatactttatctgctttctattttaatagtgaaaatg
gtgaatcctgcagcgcctattgaagatgaagaaaatgaagatgaagatgaagaagaagat
gaaaacaatctcaaagttgaacatcacgaagattatgacgaacttgtagatgacgggaaa
aaaggtgagtaa

DBGET integrated database retrieval system