KEGG   Sulfurimonas autotrophica: Saut_1706Help
Entry
Saut_1706         CDS       T01316                                 

Definition
Sec-independent protein translocase TatC
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
sua  Sulfurimonas autotrophica
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:sua00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Saut_1706
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Saut_1706
Secretion system [BR:sua02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   Saut_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1693178..1694029
Genome map
AA seq 283 aa AA seqDB search
MFDELRPHLVELRKRLAISAASLIVMFFVMFYFHEPILTWMVQPLNDALTEVGKVSVNAA
NGMITTSQVGGAFFVALKVSFFAAILGALPIILSQIWFFIAPGLYAHEKKMVFPFVAGGT
IMFLVGVLFAYYVVTPFGFDFLITFGSFKFTPLINIEDYVGFFTKIMFGFGLAFELPVFA
YFLALLGLVDDRQMTSFFKYAIVIIFIVAALLTPPDVLTQLLMAGPLVILYLLSILIVKM
VNPAAPIEDEENEDEDEEEDENNLKVEHHEDYDELVDDGKKGE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaattaagaccacaccttgtagaactccgaaaaaggctggctatatcagct
gcaagtttaatagtcatgttttttgtcatgttttactttcatgaacctatacttacatgg
atggtgcaaccactcaatgatgcacttacagaagttggtaaagtgtcagttaatgcggca
aacggtatgatcaccacctctcaagtcggcggtgcattttttgtagcattaaaagtttca
ttttttgcggccatattaggtgcactaccaattatactctcgcaaatttggtttttcatt
gctcctggtctttatgcgcatgaaaaaaaaatggtttttccttttgttgcaggaggaaca
atcatgtttcttgtgggtgtcctctttgcctactatgtcgtaacaccttttggatttgat
tttctcataacctttggttcttttaaattcaccccgcttattaatattgaagattatgta
gggttttttacaaaaatcatgtttggttttggtcttgcttttgaactgcctgtttttgcc
tactttttagcacttcttggtcttgttgatgacagacaaatgacatcatttttcaaatat
gccattgttattatttttattgttgcggcacttttaactccaccggatgtacttacacaa
cttctgatggcaggtccgcttgttatactttatctgctttctattttaatagtgaaaatg
gtgaatcctgcagcgcctattgaagatgaagaaaatgaagatgaagatgaagaagaagat
gaaaacaatctcaaagttgaacatcacgaagattatgacgaacttgtagatgacgggaaa
aaaggtgagtaa

DBGET integrated database retrieval system