KEGG   Sulfurimonas autotrophica: Saut_1743Help
Entry
Saut_1743         CDS       T01316                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saut_1743
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saut_1743
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Saut_1743
Enzymes [BR:sua01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Saut_1743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1727950..1728690
Genome map
AA seq 246 aa AA seqDB search
MKNLVAYITSGYPEKSFTVDLSLALAQNGVDTLELGVPFSDPVADGLLIEKANHKSLELG
FKFKDLLEISKEVAPQVDTLWMGYFNSFYQQNMQRLIPLAKELGVKGLIIPDLPHEEALV
YKDLFVSNDVANISFVAPTDSESRIQTVVSDAQKFIYMVAYTGITGSGTAEDLQPFLSSI
KKYTQTPVYVGFGVNEKTAKEKVKGADGVIVGSAFVNILLNNDLNYTQKITQCSELAKVI
KNEINP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaacttagtagcatatataacatccggatatccggaaaaatcttttactgtagac
ttaagtcttgcactcgcgcaaaacggtgtggacacattagagctcggtgttcctttctca
gaccctgttgctgatggtcttctcattgaaaaagcaaatcataaatcacttgaacttgga
ttcaaatttaaagatttactggaaatttcaaaagaggttgccccccaagtagacacacta
tggatgggttatttcaacagtttttatcagcaaaatatgcagcgtcttattccattggcc
aaagaacttggtgtcaaagggcttataatcccagaccttccgcatgaagaggcattggta
tacaaagatttatttgtcagtaatgatgttgcgaacatctcttttgttgcgcccacagat
agcgagagtagaatccagactgttgtcagcgatgcacaaaaatttatctatatggttgct
tacacaggtattacgggttcaggaacagcagaagatttacagccttttttaagttctatc
aaaaaatacacccaaacacctgtatatgtaggttttggggtgaatgaaaaaacagcaaaa
gagaaagtaaaaggagccgacggcgtaatagtcggcagtgcttttgtcaatattttgctt
aacaatgatttaaactatacgcaaaaaattacgcaatgcagcgaactcgcaaaagtgatt
aaaaacgagattaatccttaa

DBGET integrated database retrieval system