KEGG   Sulfurimonas autotrophica: Saut_1768Help
Entry
Saut_1768         CDS       T01316                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sua  Sulfurimonas autotrophica
Pathway
sua00900  Terpenoid backbone biosynthesis
sua01100  Metabolic pathways
sua01110  Biosynthesis of secondary metabolites
sua01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saut_1768
Enzymes [BR:sua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Saut_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADN09812
UniProt: E0UQ69
Position
complement(1755219..1756010)
Genome map
AA seq 263 aa AA seqDB search
MKKYKAYAKVNIFLKITGRRNEYHEIVSRFMRVNDLYDALSFVSKKNVQAKANEFKIIGD
FDCTTKQNTIYKAYVALKEATSSQALEKLMRTYAIAVEKHIPAFAGLGGGSSDAATYLKM
CNEVLHLGLSLNELAQIGLHVGADVPFFIYGYESANVSGIGEVVEAFDEELLAFDIYTPE
VQISTPQVYKAYRESFYAPIDGFAADELKKKSSLDILNELDAKEANDLFNPALQEYSDLE
QHYQDGYYFSGSGSSFFKVKEEK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtataaggcttatgccaaagtaaatatctttttaaaaataacaggcagaaga
aatgaataccatgaaatagtttcacgatttatgagagttaatgacttgtatgatgcactt
tcgtttgtttcgaaaaaaaatgtccaagcaaaagctaatgaatttaaaattattggtgat
tttgactgtacgacgaaacaaaatactatttacaaagcctatgtagcactcaaagaggct
acatcaagtcaggctcttgaaaaactcatgagaacctacgccattgcagttgaaaaacat
atccctgctttcgccggccttggtggaggaagtagtgatgcagcgacgtatttaaaaatg
tgtaatgaagtactgcatttaggtttgagcttgaatgaacttgcacaaatagggttacat
gtaggtgctgatgtaccgttttttatttatggatatgagagtgctaatgtaagtgggata
ggtgaagtggtagaagcttttgatgaagagttgcttgcatttgatatatatacacctgag
gtacaaataagtacacctcaagtttataaagcatacagagaaagtttttatgcaccaata
gacggatttgctgcagatgaattgaaaaaaaagtcctcattagatattttaaatgagtta
gatgccaaagaagcaaacgatttgtttaaccctgcattgcaggagtattcagatttagaa
caacattatcaagacggatactatttcagcggaagcggaagcagtttttttaaagtaaaa
gaagagaaataa

DBGET integrated database retrieval system