KEGG   Sulfurimonas autotrophica: Saut_1939Help
Entry
Saut_1939         CDS       T01316                                 

Definition
thiamine pyrophosphate domain-containing TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saut_1939
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_1939
   00020 Citrate cycle (TCA cycle)
    Saut_1939
   00620 Pyruvate metabolism
    Saut_1939
   00640 Propanoate metabolism
    Saut_1939
   00650 Butanoate metabolism
    Saut_1939
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saut_1939
   00680 Methane metabolism
    Saut_1939
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Saut_1939
Enzymes [BR:sua01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Saut_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1925131..1926087)
Genome map
AA seq 318 aa AA seqDB search
MSEMKKIKNLKEFSTSADRFEGANLLCPGCAHSIIVREVLNATNDDLVLAASTGCLEVCT
AVYPYTSWDASWIHIGFENGSTAVAGAEAMYKALKNKGRLKQPDRNPKFVAFGGDGASYD
IGFQWISGCMERGHNMMYVVLDNEVYANTGGQRSSSTPIGASATTTPAGRVSYGETKNKK
DMMSIMAAHHIPYAAQVAPNKWKDMVKKIQHGMEVDGPVFINAVSPCTTEWKFDPKDTMH
ITDLATDSLVFPLYEIIDGHELNITYRPKNVVPVEEYLAAQGRFKHLFKDEYKYLIKEWQ
ERVDANWAYLNRREEARV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatgaaaaaaataaaaaacttaaaagagttttctacatcagcagaccgtttt
gaaggtgcaaaccttctttgccccggttgtgcacactctatcattgttcgtgaagtttta
aacgcgacaaatgatgacttggttcttgcagcatcaactggatgtttggaagtatgtacg
gctgtttatccatatacatcttgggatgcttcttggattcatatcggttttgaaaacggt
tcaactgcagttgcaggtgctgaagctatgtataaagcactgaagaataaaggtcgccta
aagcagcctgaccgtaatcctaagtttgttgcttttggtggagacggtgcttcttatgat
atcggttttcagtggatatctggctgtatggaacgtggtcacaacatgatgtatgttgtt
cttgataatgaagtatatgcaaatacgggtggacaacgttcatcatcaacaccaatcggt
gcatcagcaacaacaacacctgctggtcgtgtaagttatggtgagactaaaaacaaaaaa
gatatgatgagtattatggctgcccatcatataccatatgcggcacaggttgctccaaat
aaatggaaagacatggtgaaaaaaatccaacatggtatggaagttgacggacctgtattt
atcaatgcagtttctccttgtactactgagtggaaatttgaccctaaagatacgatgcac
ataacagatcttgcaactgattcattggtatttccattgtatgaaatcattgacgggcat
gagttaaatattacttacagacctaaaaatgttgttcctgttgaagaatatcttgcagca
caagggcgttttaaacatctttttaaagatgagtataagtacttaattaaagagtggcaa
gagcgtgtagacgcaaactgggcgtatctaaacagacgtgaagaagctcgcgtatag

DBGET integrated database retrieval system