KEGG   Sulfurimonas autotrophica: Saut_1941Help
Entry
Saut_1941         CDS       T01316                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sua  Sulfurimonas autotrophica
Pathway
sua00010  Glycolysis / Gluconeogenesis
sua00020  Citrate cycle (TCA cycle)
sua00620  Pyruvate metabolism
sua00640  Propanoate metabolism
sua00650  Butanoate metabolism
sua00680  Methane metabolism
sua00720  Carbon fixation pathways in prokaryotes
sua01100  Metabolic pathways
sua01120  Microbial metabolism in diverse environments
sua01130  Biosynthesis of antibiotics
sua01200  Carbon metabolism
Module
sua_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
sua_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_1941
   00020 Citrate cycle (TCA cycle)
    Saut_1941
   00620 Pyruvate metabolism
    Saut_1941
   00640 Propanoate metabolism
    Saut_1941
   00650 Butanoate metabolism
    Saut_1941
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saut_1941
   00680 Methane metabolism
    Saut_1941
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Saut_1941
Enzymes [BR:sua01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Saut_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_7 Fer4_6 Fer4_13 Fer4_8 Fer4_16 Fer4_15 Fer4_4 Fer4_17 Fer4_3 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ADN09984
UniProt: E0UR28
Position
complement(1927321..1927716)
Genome map
AA seq 131 aa AA seqDB search
MANTGWDEFEIGAMLRTFEGEAGDIAGTLQEDRNYTENSSFRASVADWRIEKPVFNKDFC
IDCQFCWVYCPDISIISRDKKMIGIDMDHCKGCGICVEVCPTNPKSLLMFPEKADEETEI
ANWPAKETKEK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatacaggttgggacgaatttgaaatcggagcaatgcttcgtacatttgagggt
gaggctggtgatatagccggaacacttcaggaagatcgtaattacacagagaacagttcg
tttcgtgcgagtgtggcagattggagaattgaaaaaccggtttttaataaagatttttgt
atagattgtcaattttgctgggtatattgtccagacatttcaattatttcaagagataaa
aaaatgataggtatagatatggatcactgtaaagggtgtggtatctgtgttgaggtttgt
cctacaaatccaaaatcacttttaatgttcccggaaaaagcagacgaagagacagaaata
gcaaattggcctgctaaagaaacaaaggagaaatag

DBGET integrated database retrieval system