KEGG   Sulfurimonas autotrophica: Saut_1942Help
Entry
Saut_1942         CDS       T01316                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saut_1942
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_1942
   00020 Citrate cycle (TCA cycle)
    Saut_1942
   00620 Pyruvate metabolism
    Saut_1942
   00640 Propanoate metabolism
    Saut_1942
   00650 Butanoate metabolism
    Saut_1942
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saut_1942
   00680 Methane metabolism
    Saut_1942
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Saut_1942
Enzymes [BR:sua01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Saut_1942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1927727..1928284)
Genome map
AA seq 185 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLADVISTTGKEVQAFAFYGSAKRGAAMTAYNRVDDKVIMN
HEKYMEPDYVFVIDPALVYTTDVTINGKEDTKYIITTHMSTDELVASQPKLEGKEVHTVD
CIKIAQETIGRAIPNTPMLGAFMKISGMYDIDFFKESMQRILKKLPQKIIDANMIAIQRA
YDEVK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaattagatggcatagtcgtgcgggtcaaggtgctgtaacaggtgctaaaggc
ttggctgacgttatttctacaacgggaaaagaagtacaggcatttgcattctacggttct
gcaaaacgtggagctgctatgacagcatataaccgtgttgatgataaagtcattatgaac
catgaaaaatacatggaaccggattatgtctttgtaattgacccggctttagtttacaca
acagatgtaactattaatggcaaagaagatacaaaatatataatcacaacacatatgagc
acagatgaacttgttgcatctcaaccaaaattagaaggtaaagaagtacatactgttgac
tgtattaaaatagcacaagagactattggtcgtgcaattccaaatacaccgatgcttggt
gcctttatgaaaatatccggtatgtatgacattgattttttcaaagaaagtatgcagaga
attcttaaaaaattaccacaaaagattattgatgcaaatatgatagcgattcaacgcgca
tatgacgaagtaaaataa

DBGET integrated database retrieval system