KEGG   Sulfurimonas autotrophica: Saut_2011Help
Entry
Saut_2011         CDS       T01316                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sua  Sulfurimonas autotrophica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1994304..1995221
Genome map
AA seq 305 aa AA seqDB search
MHKTIIIFFLFSLTLLMASEPITPLPQNVKVNQTKAKLGKELFFDPILSHDDTISCATCH
NLQQGGDDGLKFSFGIKGQEGIVNAPTVYNAYFNFRQFWDGRAKDLQEQAAGPIENPIEM
GSSFEEVIAKLKKSKYKKLFDALYKEGITKQTISDAIAEYEKTLITPNSRFDNYLRGDEN
ALTQNEKEGYELFKSKGCASCHHGENIGGNLYNKFGIFDETNSEWLGRYNITHKERDKYF
FKVPSLRNIARTAPYFHDGRTYNLKEAVQIMSQYQLGRHITKEEISKITAFLKSLNGELP
KNIEP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaacaataattatattttttcttttcagtcttactcttttaatggcaagtgag
cctatcactccattgccccagaatgtaaaagtcaaccaaacaaaagcaaaactcggaaaa
gagctcttttttgaccctattctctcgcatgatgacactatcagctgtgcaacatgccac
aacttgcaacagggtggtgatgatggactcaagttttcttttggtattaaaggacaagag
gggatagttaatgctcctactgtctataatgcctattttaatttccgacaattttgggat
ggccgggcaaaagatctgcaagaacaagccgcaggacctattgaaaatcctattgaaatg
ggctcttcctttgaggaagtcatagcaaaactcaaaaaaagcaaatataaaaaacttttt
gatgcactttataaggagggcattaccaaacaaaccattagtgatgccatagcagagtat
gaaaaaactctcattactccaaattctcgctttgacaactatctcagaggcgatgaaaac
gcactcacgcaaaatgaaaaagaagggtatgagctttttaagtcaaagggatgtgcaagc
tgtcaccacggggaaaatattggtggcaacctgtataataaattcggtatttttgacgaa
acaaactcagaatggctgggaagatacaatattactcacaaagagagagataaatatttc
tttaaagttccctcacttcgtaatattgcaagaaccgcgccctactttcatgatggacgg
acatataatcttaaagaagctgttcaaattatgtctcagtatcaacttggccgccatatt
acaaaagaagagatttcaaagataacagcttttttaaaatcactcaatggtgaacttcct
aaaaatattgagccctga

DBGET integrated database retrieval system