KEGG   Sulfurimonas autotrophica: Saut_2146Help
Entry
Saut_2146         CDS       T01316                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sua  Sulfurimonas autotrophica
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sua00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2136811..2137395)
Genome map
AA seq 194 aa AA seqDB search
MSDNKNSEFENAVKVMMHHVGEDPQREGLIDTPSRVRKAYEFIYGGYKEDPAEILKKALF
TTSNDEMVLVKDIEFYSTCEHHLLPIIGRVHVAYIPDGKVVGLSKIPRVVNVFARRMQIQ
EQLTEQIADAIMDTIAPKGVGVVIQARHMCMEMRGVEKINSTTTSSALRGLFKKDEKTRS
EFFSLINSPTGNRY
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagataataaaaacagtgaatttgaaaacgcagtaaaagtcatgatgcatcatgtt
ggagaagatcctcagcgtgagggtttaatagataccccttcaagagtaagaaaggcctat
gaatttatttatggcggatataaagaagatccggcagagattttaaaaaaagctcttttt
acgacttcaaatgatgaaatggttttagtaaaagatatagagttttattctacatgcgag
catcatcttttacctattattggtcgtgtacatgtagcttatattcccgatggaaaggtt
gttggactttcaaaaattcctcgtgttgtcaatgtgtttgcccgtcgcatgcagattcaa
gaacagttgacagaacagatagcagatgccattatggatacgattgcaccaaaaggtgtt
ggtgttgttattcaggcacgtcacatgtgtatggagatgcgcggtgttgaaaaaataaat
tcaacaacaacatcttcagcacttcgcggacttttcaaaaaagatgaaaaaacacgaagt
gaattcttttcacttataaattctcctacgggaaacagatattaa

DBGET integrated database retrieval system