KEGG   Sulfurimonas autotrophica: Saut_2146Help
Entry
Saut_2146         CDS       T01316                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sua  Sulfurimonas autotrophica
Pathway
sua00790  Folate biosynthesis
sua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Saut_2146
Enzymes [BR:sua01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Saut_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha Spike_torovirin DUF3638
Motif
Other DBs
NCBI-ProteinID: ADN10188
UniProt: E0US95
Position
complement(2136811..2137395)
Genome map
AA seq 194 aa AA seqDB search
MSDNKNSEFENAVKVMMHHVGEDPQREGLIDTPSRVRKAYEFIYGGYKEDPAEILKKALF
TTSNDEMVLVKDIEFYSTCEHHLLPIIGRVHVAYIPDGKVVGLSKIPRVVNVFARRMQIQ
EQLTEQIADAIMDTIAPKGVGVVIQARHMCMEMRGVEKINSTTTSSALRGLFKKDEKTRS
EFFSLINSPTGNRY
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagataataaaaacagtgaatttgaaaacgcagtaaaagtcatgatgcatcatgtt
ggagaagatcctcagcgtgagggtttaatagataccccttcaagagtaagaaaggcctat
gaatttatttatggcggatataaagaagatccggcagagattttaaaaaaagctcttttt
acgacttcaaatgatgaaatggttttagtaaaagatatagagttttattctacatgcgag
catcatcttttacctattattggtcgtgtacatgtagcttatattcccgatggaaaggtt
gttggactttcaaaaattcctcgtgttgtcaatgtgtttgcccgtcgcatgcagattcaa
gaacagttgacagaacagatagcagatgccattatggatacgattgcaccaaaaggtgtt
ggtgttgttattcaggcacgtcacatgtgtatggagatgcgcggtgttgaaaaaataaat
tcaacaacaacatcttcagcacttcgcggacttttcaaaaaagatgaaaaaacacgaagt
gaattcttttcacttataaattctcctacgggaaacagatattaa

DBGET integrated database retrieval system