KEGG   Streptococcus uberis: SUB0065Help
Entry
SUB0065           CDS       T00849                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sub  Streptococcus uberis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sub01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sub00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:sub00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70212..71699
Genome map
AA seq 495 aa AA seqDB search
MGLIYQSTRDQCNQVSASQAILSGLASDGGLYTPIKLPKLDLNFDDLQSASYQEIAKLIM
SAFFDDFTDEELDHCISSAYDDKFDTDLIAPIVSLKDYHNLELFHGATIAFKDMALSILP
HLLTTAAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKHGVSKIQELQMT
TQKGQNTHVIAIEGNFDDAQTEVKRMFNDQELAAKLAKQGIQLSSANSMNIGRLIPQVVY
YVYAYAQLVKKRSIQVGDEINITVPTGNFGNILAAYYAKEIGLPVSKLICASNENNVLTD
FFTNLTYNKKRPFKVTSSPSMDILVSSNLERLIFHLLGNDSEKTKELMFKLSKDGEYQLE
GIQEDIFNIFRAGFASEEETKAEIRAIFESDNYVIDPHTAVASAVYREYQKISGDQTLTV
IASTASPYKFPCVVVNSISSEFIESDFKAVEALEKLSGVTIPKAVRGLEKAEVLHETLVA
TKDMQEAVEKYLGVQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggtttaatttatcaatcaacacgtgatcaatgtaatcaagtaagcgctagccaagct
atattgagtggattagcttctgatggtggcttatatacaccaattaaactaccaaagctt
gatttgaattttgacgatttgcagtcagcttcttatcaggaaattgctaaattgattatg
tcagcattctttgatgattttactgatgaagaattagatcactgtatttcgtctgcttat
gacgacaagtttgatacggatcttattgcaccgatagtgtcattaaaggattatcacaat
ttagagttattccatggggctactattgcctttaaagatatggccttatctattttgcct
catttactaacaactgctgcaaaaaaacaaggtgttgacaataaaatagtgattttaaca
gcaacttcaggtgatactggtaaggcagcaatggccggctttgcagatgttccgggtaca
gagattattgttttttatcctaaacatggggttagcaaaattcaagagcttcaaatgaca
acgcaaaaagggcaaaacacacatgttattgcaattgaaggtaactttgatgatgctcaa
acggaagttaagcggatgttcaatgaccaggaattagctgccaaattggcaaaacaaggt
attcaattgtcatcagctaactctatgaatattggtcggttaattcctcaggttgtttat
tatgtttatgcctatgctcaattggtgaaaaagcgcagcattcaagtaggtgatgagatt
aacattacggttccaactggtaatttcggtaatatcttagctgcttattatgctaaagaa
attggtctgccggtttctaagctaatttgtgcttcaaatgaaaataatgttttgaccgac
ttctttaccaacttaacttataataagaaacgtcctttcaaagtgaccagcagcccgtct
atggatattttggtctcttcaaatctagaacgccttattttccatttacttggcaatgac
tctgaaaaaactaaagaacttatgtttaagctgtccaaagatggtgagtatcagcttgaa
ggcattcaagaggatatttttaatatttttagagctggttttgcttcggaagaagagact
aaagctgaaatcagagcaatttttgaaagtgataactatgttattgatcctcacacggct
gtagcctcagctgtttatagagagtatcaaaaaattagtggagatcaaactctaacggtg
attgcctcaacagctagtccttataaatttccgtgtgtagtggtaaattccattagttca
gaatttattgaaagtgattttaaagcggtggaagcattagaaaaattatctggtgtaacg
attccgaaggcagtcagaggtcttgaaaaagcagaagtattgcatgagaccttggttgcg
acaaaggatatgcaagaggcagttgaaaaatacttaggagtacagtaa

DBGET integrated database retrieval system