KEGG   Streptococcus uberis: SUB0065Help
Entry
SUB0065           CDS       T00849                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sub  Streptococcus uberis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SUB0065
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SUB0065
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SUB0065
Enzymes [BR:sub01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SUB0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70212..71699
Genome map
AA seq 495 aa AA seqDB search
MGLIYQSTRDQCNQVSASQAILSGLASDGGLYTPIKLPKLDLNFDDLQSASYQEIAKLIM
SAFFDDFTDEELDHCISSAYDDKFDTDLIAPIVSLKDYHNLELFHGATIAFKDMALSILP
HLLTTAAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKHGVSKIQELQMT
TQKGQNTHVIAIEGNFDDAQTEVKRMFNDQELAAKLAKQGIQLSSANSMNIGRLIPQVVY
YVYAYAQLVKKRSIQVGDEINITVPTGNFGNILAAYYAKEIGLPVSKLICASNENNVLTD
FFTNLTYNKKRPFKVTSSPSMDILVSSNLERLIFHLLGNDSEKTKELMFKLSKDGEYQLE
GIQEDIFNIFRAGFASEEETKAEIRAIFESDNYVIDPHTAVASAVYREYQKISGDQTLTV
IASTASPYKFPCVVVNSISSEFIESDFKAVEALEKLSGVTIPKAVRGLEKAEVLHETLVA
TKDMQEAVEKYLGVQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggtttaatttatcaatcaacacgtgatcaatgtaatcaagtaagcgctagccaagct
atattgagtggattagcttctgatggtggcttatatacaccaattaaactaccaaagctt
gatttgaattttgacgatttgcagtcagcttcttatcaggaaattgctaaattgattatg
tcagcattctttgatgattttactgatgaagaattagatcactgtatttcgtctgcttat
gacgacaagtttgatacggatcttattgcaccgatagtgtcattaaaggattatcacaat
ttagagttattccatggggctactattgcctttaaagatatggccttatctattttgcct
catttactaacaactgctgcaaaaaaacaaggtgttgacaataaaatagtgattttaaca
gcaacttcaggtgatactggtaaggcagcaatggccggctttgcagatgttccgggtaca
gagattattgttttttatcctaaacatggggttagcaaaattcaagagcttcaaatgaca
acgcaaaaagggcaaaacacacatgttattgcaattgaaggtaactttgatgatgctcaa
acggaagttaagcggatgttcaatgaccaggaattagctgccaaattggcaaaacaaggt
attcaattgtcatcagctaactctatgaatattggtcggttaattcctcaggttgtttat
tatgtttatgcctatgctcaattggtgaaaaagcgcagcattcaagtaggtgatgagatt
aacattacggttccaactggtaatttcggtaatatcttagctgcttattatgctaaagaa
attggtctgccggtttctaagctaatttgtgcttcaaatgaaaataatgttttgaccgac
ttctttaccaacttaacttataataagaaacgtcctttcaaagtgaccagcagcccgtct
atggatattttggtctcttcaaatctagaacgccttattttccatttacttggcaatgac
tctgaaaaaactaaagaacttatgtttaagctgtccaaagatggtgagtatcagcttgaa
ggcattcaagaggatatttttaatatttttagagctggttttgcttcggaagaagagact
aaagctgaaatcagagcaatttttgaaagtgataactatgttattgatcctcacacggct
gtagcctcagctgtttatagagagtatcaaaaaattagtggagatcaaactctaacggtg
attgcctcaacagctagtccttataaatttccgtgtgtagtggtaaattccattagttca
gaatttattgaaagtgattttaaagcggtggaagcattagaaaaattatctggtgtaacg
attccgaaggcagtcagaggtcttgaaaaagcagaagtattgcatgagaccttggttgcg
acaaaggatatgcaagaggcagttgaaaaatacttaggagtacagtaa

DBGET integrated database retrieval system