KEGG   Streptococcus uberis: SUB0101Help
Entry
SUB0101           CDS       T00849                                 

Definition
zinc-binding dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sub  Streptococcus uberis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SUB0101
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB0101
  Lipid metabolism
   00071 Fatty acid degradation
    SUB0101
  Amino acid metabolism
   00350 Tyrosine metabolism
    SUB0101
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SUB0101
   00626 Naphthalene degradation
    SUB0101
Enzymes [BR:sub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SUB0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97545..98591
Genome map
AA seq 348 aa AA seqDB search
MKATIFQEAGLVHVEEIAKPVIQENDDVIIKVVRACVCGSDLWAYSHGDKKAAHSINDGH
EALGIVEEVGSEITTVQPGDFVIVPFTHGCGECDACRAGFDGTCDNHPGYSNWSNGFQSE
YIRFHYGNWALVKVPGQPTDYSEDMIKSLLTLADVMPTGYHAARCAQVSAGDKVVVIGDG
AVGQCAVIAAKMMGASQIILMSRHKDRQEMALASGATAVVAERGEEGIAKVREILGGGAD
AALECVGTEAAMDQALGVLHNGGRVGFVGVPHYNNRALGSTFAQNISVAGGSASVTTYDK
NVLLKAVLDGDINPGRVFTQTYALSDVNQAYKDMQERKTIKSMLIIAE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaacaattttccaagaagcaggcctagttcatgttgaagaaattgccaaacct
gtcatccaagaaaatgatgatgtgattatcaaagttgtcagagcttgtgtttgcggttct
gatttgtgggcatactcacacggggacaaaaaagcagcacattccatcaatgatggccat
gaagccttaggtattgtcgaagaagtcggttcggaaatcacaacagttcaaccaggtgat
tttgttattgttccttttacccatggttgtggggaatgcgatgcctgtcgagctggcttt
gatggcacatgtgataaccatcctggttacagtaattggtctaatggtttccaatcagaa
tatattcgttttcattatggtaattgggctttggtaaaagtacctggtcagcctacagat
tattctgaagatatgattaaatccttattaacccttgccgatgttatgccgacaggatat
cacgctgctcggtgtgctcaagtatcagctggtgataaggttgttgtgattggagatggt
gcagttggacaatgtgctgtcattgctgccaagatgatgggtgcttctcaaattatttta
atgagtcgccataaagaccgtcaagaaatggcccttgcatcaggtgcgacggccgtggtt
gctgaacgtggcgaggaagggattgctaaagtaagggaaattctcggcggtggtgcggat
gctgccttagaatgtgttggtacggaagcagccatggatcaggctttaggtgtccttcat
aatggtggtcgagttggttttgtcggcgttccacattataataatagagctttagggtca
acctttgcgcaaaatatttcagttgcaggaggatctgcgtctgtcacaacatatgataaa
aatgtgcttttaaaagcagttctcgacggggatattaacccaggacgtgtcttcacccag
acatatgctttgtcggatgtcaatcaagcttacaaagatatgcaagaacgtaaaacgata
aaatcaatgctgattattgctgaataa

DBGET integrated database retrieval system