KEGG   Streptococcus uberis: SUB0309Help
Entry
SUB0309           CDS       T00849                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sub  Streptococcus uberis
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB0309
Enzymes [BR:sub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SUB0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
301593..303050
Genome map
AA seq 485 aa AA seqDB search
MAIFRDDFLWGGAIAANQVEGAWNLDGKGMSVADVASFKPHLDVKDYAGHNKVTSQMIEE
AMAAGDSKDYPKRRGIDFYHHYEEDIALFAEMGFKALRLSIAWTRLYPTGEESEPNPEGI
AFYKRVFECLKAHGIQPIVTLSHYEMPLHLSVTYNGWVDRSIIDHFVRFAETCFREFGDY
VTYWLTFNEVDSVGRHPFTTAGIIPDRCTDYSLEEAVYQALHHQYVAAALATKKMRQLIP
GSHMGCMLTKLTTYPNTCHPNDVLLSLSKNLENYAHSDVQIFGCYPRLYQHFLASKGIRI
KAERGDHAILAEGKADYLAFSYYMSRTESADPTKEQVAGNTIMSVKNPYLASTDWGWQID
PVGLRISLLELYDRYQIPLMIVENGMGALDHLEEDGKIHDSYRIDYLREHIVEMAKAVEM
GVDLLGYTSWAPIDLISVSTSQMSKRYGYIYVDQDDLGQGSLERYRKDSFYWYQKVIQSN
GEDLE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggctatttttagagatgattttctttggggtggtgccattgctgccaatcaagtagag
ggtgcttggaatttggatggtaaaggcatgtctgttgctgatgtggctagcttcaagccg
catttggatgtgaaggattatgctggacacaataaagtgacctcgcaaatgattgaggaa
gctatggcggcgggagattcaaaggattaccccaaacgtcgaggcatcgatttctatcac
cattatgaagaagatattgccttgtttgctgaaatgggctttaaggctttgcgtctgtct
attgcctggacacgtctttacccaactggggaagaaagtgagcctaatccagaaggtatc
gctttttacaagagggtttttgagtgccttaaagctcatggtatccaacccattgtaacc
ctatctcactatgagatgcccttgcatttgagtgtcacttacaatggctgggtggaccgt
tctatcatcgatcactttgtacgctttgctgaaacctgtttccgagaatttggagactat
gtgacctattggttgaccttcaacgaagtggattctgtcggtcgacaccccttcaccaca
gcaggtatcattccagaccgttgcaccgactatagtttagaagaagcagtctaccaagct
cttcaccatcagtatgtcgcggcagctttggccacaaagaaaatgcgacaactcatcccg
ggcagtcacatgggctgtatgctaaccaaattaaccacctaccctaacacctgtcaccct
aacgacgttctcctgtccttgtctaaaaatctggaaaactacgctcattccgatgttcaa
attttcggttgctacccaaggttgtatcagcatttcttggcttccaagggtattaggata
aaagcagagcgaggagatcatgccattctggctgaagggaaagctgactacctagcattc
tcatactacatgtcgcggacagaatcagctgaccccactaaagaacaagtggcgggcaat
accatcatgagtgttaaaaacccttacctagcctcaacagactggggttggcagattgat
ccggttggtctacgtatttctctcttggaactctatgatcgttaccaaattcccttgatg
attgttgaaaacggtatgggagcacttgatcacctggaagaagacgggaaaatccacgat
tcctaccgcatcgactacctcagagaacacattgttgagatggcaaaagcagtggaaatg
ggagttgatttgttgggctatactagctgggctcctatcgatttaatcagtgtctccacg
tcacaaatgtctaaacgctatggttacatttatgtggatcaagatgatttaggacaaggc
agcctagaacgttaccgaaaagattccttctattggtatcaaaaagtcatccaaagtaat
ggtgaggatttggagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system