KEGG   Streptococcus uberis: SUB0367Help
Entry
SUB0367           CDS       T00849                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sub  Streptococcus uberis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sub01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sub00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
366438..367811
Genome map
AA seq 457 aa AA seqDB search
MNQKTSQLSQKIFESNPVITFYIDKLNELLSIKSIFAQDVGLEEAANFLSSLFKEAGAEV
TLDKSFKAPFLIARFKSSSPNAKTLLFYNHYDTVPADSDQKWHFEPFTLSIKENKMYGRG
VDDDKGHIIARLTAVINYLNNHKDLPINVTFIMEGAEESASVDLESYLLAHQEELSKADL
LIWEQGIKNEKNQLELTGGNKGILTFDMAVKSADSDIHSKYGGVVDSATWYLLRAISSLR
DDQGHLLVDGIYDKIKPANQRELALVEQFAVENPEIVKKLYGLSLPMLQSDRRAFLRRYY
FEPSVTIQGISSGYLGSGVKTIIPSYASAKMEIRLVPGLDPKEVFEAVSNHLRVHGFGLV
ELNYTLGEKSYRSDLSSPEVQALIDLVSQNHPGGVCLLPTSAGTGPMHTVYSVLKVPMVS
LGMGNPNSSDHSGDENVLISDYLEHITLIEELIKSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaagacaagtcaattgagtcaaaaaatatttgaaagcaatcctgtcattacg
ttttacattgataagttaaatgaactactatccattaaatctatttttgcccaagatgtg
ggcctggaagaagcagccaattttttgtcgtcactttttaaagaggccggtgcagaagta
acactggataagagtttcaaagcaccttttcttattgcacgctttaagagttcatctccc
aatgccaaaacgctgcttttttataatcattatgatacagttcctgcagattctgaccaa
aaatggcactttgaacctttcacattaagtattaaggaaaataagatgtatggtcgagga
gtagatgatgataaagggcacatcattgctaggctgacagctgttatcaattatttgaat
aaccataaagacttaccaataaatgtgacctttattatggaaggtgcggaggagtcggca
tctgttgacttggaatcctatttattagctcatcaagaagagttgtcaaaagcggatctt
ttaatttgggagcaagggattaaaaatgagaagaatcaattagaattgacaggtggtaat
aagggcattttgacatttgacatggctgttaagagtgcagatagtgacatacattcaaaa
tatggaggagttgtggattctgccacttggtacttgttaagagctatttcgagtctacgt
gatgatcagggtcaccttttggttgatggcatttatgacaaaatcaagcctgcaaatcaa
cgtgaattagctttagtggaacaattcgccgtcgaaaacccagaaattgtgaaaaaactt
tacggacttagcctacctatgttacaatcagacagacgtgcatttttgagacgttattat
tttgaaccatctgtaaccatacaaggtatttcctctggttatttggggagtggggttaaa
accatcattccttcctatgcttctgctaaaatggaaatcagattggttcctggtcttgat
ccgaaagaggtttttgaagctgtttcaaaccacttgcgtgtccatggatttggtcttgtg
gaacttaattataccttgggtgagaaaagctatcgaagtgatttatcttcgccagaagtt
caagccttgattgatctagtatcacaaaatcatccaggaggggtttgtttgttaccaact
tcggctggaacaggtccgatgcatacggtatatagtgttttaaaggtaccaatggtttct
ttgggcatgggaaatccaaacagttcggaccattcaggagacgaaaacgttctaatttca
gactatctagaacatatcacacttattgaggagttaataaaaagttatgagtga

DBGET integrated database retrieval system