KEGG   Streptococcus uberis: SUB0605Help
Entry
SUB0605           CDS       T00849                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sub  Streptococcus uberis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUB0605 (tpiA)
   01230 Biosynthesis of amino acids
    SUB0605 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB0605 (tpiA)
   00051 Fructose and mannose metabolism
    SUB0605 (tpiA)
   00562 Inositol phosphate metabolism
    SUB0605 (tpiA)
Enzymes [BR:sub01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SUB0605 (tpiA)
Exosome [BR:sub04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SUB0605 (tpiA)
  Exosomal proteins of bladder cancer cells
   SUB0605 (tpiA)
  Exosomal proteins of melanoma cells
   SUB0605 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
572658..573416
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFIEAVVSKLPSSELVEAGIAAPALDLSTVLEAAKGSDL
KIAAQNAYFENAGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLTEEQVSSLVIAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQTVADKVRVQYGGSVKPENVASYMSCPDVDGALVGGASLE
ADSFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttattgctggtaactggaaaatgaacaaaaatcctgaagaagct
aaagctttcattgaagctgttgtttcaaaattaccttcatcagagttagttgaagctgga
attgctgcacctgctcttgatctttcaacagttcttgaagctgcaaaaggttctgatctt
aaaattgctgctcaaaatgcttattttgaaaatgctggagcttttacaggtgaaaatagt
cctaaagttcttgctgaaatgggaacagattatgttgttattggtcattcagaacgtcgt
gattacttccatgaaactgatgaagacatcaataaaaaagctaaagctatctttgcaaac
ggtttaacacctattatttgttgtggtgaatcattagaaacatacgaagctggtaaagcg
gtagagtttgtgggagctcaagtttctgcagcattagctggtttaacagaagaacaagtt
tcttctcttgttattgcatatgagccaatctgggcaatcggaactggtaaatctgcaact
caagatgatgcacaaaacatgtgtaaagcagttcgtgatgttgtagctgctgactttggt
caaacagttgctgataaagtacgtgttcaatatggtggttctgttaaacctgaaaacgtt
gcttcatatatgtcatgtccagatgttgacggtgctttagttggtggagcatcacttgaa
gcagatagcttcttagcattacttgactttgttaaataa

DBGET integrated database retrieval system