KEGG   Streptococcus uberis: SUB0605Help
Entry
SUB0605           CDS       T00849                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sub  Streptococcus uberis
Pathway
sub00010  Glycolysis / Gluconeogenesis
sub00051  Fructose and mannose metabolism
sub00562  Inositol phosphate metabolism
sub01100  Metabolic pathways
sub01110  Biosynthesis of secondary metabolites
sub01120  Microbial metabolism in diverse environments
sub01130  Biosynthesis of antibiotics
sub01200  Carbon metabolism
sub01230  Biosynthesis of amino acids
Module
sub_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sub_M00002  Glycolysis, core module involving three-carbon compounds
sub_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB0605 (tpi)
   00051 Fructose and mannose metabolism
    SUB0605 (tpi)
   00562 Inositol phosphate metabolism
    SUB0605 (tpi)
Enzymes [BR:sub01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SUB0605 (tpi)
Exosome [BR:sub04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SUB0605 (tpi)
  Exosomal proteins of bladder cancer cells
   SUB0605 (tpi)
  Exosomal proteins of melanoma cells
   SUB0605 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAR41419
UniProt: B9DRM0
Position
572658..573416
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFIEAVVSKLPSSELVEAGIAAPALDLSTVLEAAKGSDL
KIAAQNAYFENAGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLTEEQVSSLVIAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQTVADKVRVQYGGSVKPENVASYMSCPDVDGALVGGASLE
ADSFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttattgctggtaactggaaaatgaacaaaaatcctgaagaagct
aaagctttcattgaagctgttgtttcaaaattaccttcatcagagttagttgaagctgga
attgctgcacctgctcttgatctttcaacagttcttgaagctgcaaaaggttctgatctt
aaaattgctgctcaaaatgcttattttgaaaatgctggagcttttacaggtgaaaatagt
cctaaagttcttgctgaaatgggaacagattatgttgttattggtcattcagaacgtcgt
gattacttccatgaaactgatgaagacatcaataaaaaagctaaagctatctttgcaaac
ggtttaacacctattatttgttgtggtgaatcattagaaacatacgaagctggtaaagcg
gtagagtttgtgggagctcaagtttctgcagcattagctggtttaacagaagaacaagtt
tcttctcttgttattgcatatgagccaatctgggcaatcggaactggtaaatctgcaact
caagatgatgcacaaaacatgtgtaaagcagttcgtgatgttgtagctgctgactttggt
caaacagttgctgataaagtacgtgttcaatatggtggttctgttaaacctgaaaacgtt
gcttcatatatgtcatgtccagatgttgacggtgctttagttggtggagcatcacttgaa
gcagatagcttcttagcattacttgactttgttaaataa

DBGET integrated database retrieval system