KEGG   Streptococcus uberis: SUB0619Help
Entry
SUB0619           CDS       T00849                                 

Definition
(GenBank) putative fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sub  Streptococcus uberis
Pathway
sub00010  Glycolysis / Gluconeogenesis
sub00030  Pentose phosphate pathway
sub00051  Fructose and mannose metabolism
sub00680  Methane metabolism
sub01100  Metabolic pathways
sub01110  Biosynthesis of secondary metabolites
sub01120  Microbial metabolism in diverse environments
sub01130  Biosynthesis of antibiotics
sub01200  Carbon metabolism
Module
sub_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB0619
   00030 Pentose phosphate pathway
    SUB0619
   00051 Fructose and mannose metabolism
    SUB0619
  Energy metabolism
   00680 Methane metabolism
    SUB0619
Enzymes [BR:sub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SUB0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos DUF2507
Motif
Other DBs
NCBI-ProteinID: CAR41447
UniProt: B9DRN4
Position
585260..587176
Genome map
AA seq 638 aa AA seqDB search
MSQYFSLLKEKFPTKSSLLTEMINLDAICHLPKGTEYFLSDLHGEYQAFDYLLRNASGSI
KKKLQECFPEKDSEDIDKLCQYIYYPSEKIAAQQEILGEKALQEELSFYLPDLIQFVKYT
GSKYTRSKVRKMLPADYAYIMEELLTEEQPDKNKHFYYQAILAKVIELEQLDNLFVAFAQ
LIQKLSIDHLHIVGDIFDRGKYPDFILERLRSFRNIDIQWGNHDITWIGAISGSYICMIN
VIRIAARYNSIDLIEDRYGINLRRLIEYSQSHFQEEDVFNPILDGEEIADSERMVLNQLQ
QATALLQFKLEHQLIKRRPCFGMEAGLLFSKIDTENQTITIGDITYPLQSFPFEMMDWDN
PDGLTEEEEALLKGLMYRFQNSTLLKEHVDFLIEKGGMYHISNNHLLFHGCMPMHSNGDF
KSMVFGKQAYSGRALLDFFEEQVLESYKNPDSHEDFQTDIFWYLWCGEVSSLFGKDRMTT
FERYYIADKTSHVEHKNPYYKLRENEEICLRILEEFGLDKSAHIVNGHTPVKEKGGELPI
KANGRMIIIDGGLAKGYQKTTGIAGYTLISNSYGLELVAHKPFSSVQDVLEGKCDIIFIK
RLVEIVENRTLVKETDNGQLLLKEIADLEYLYHHFDQF
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagtattttagtcttttaaaagagaaatttcctacgaaatcctccctccttacg
gaaatgataaatttagatgccatttgtcatttaccaaaagggacggagtattttttaagt
gatttacatggagaataccaagcttttgactatttacttagaaatgcttcaggttcaatc
aaaaagaaattgcaagaatgttttcctgaaaaagattctgaagacattgacaaactgtgt
cagtatatttattatccttctgaaaaaattgctgcccaacaagaaattctaggagaaaag
gctctccaagaagaattgtccttctatcttccagatctcattcagtttgttaaatacaca
gggagtaaatacacccgttcgaaagttcgaaaaatgttaccggctgattatgcctatatt
atggaggaactattaactgaggagcagcctgataagaataaacatttttattatcaagct
attcttgccaaagtcattgaattggagcaattagacaatctttttgtcgcttttgctcag
ctgatacaaaagctttcaattgatcatttgcatattgttggtgatatttttgaccgtggg
aaataccctgacttcattttagagagattaagatcctttcgaaatattgatatccaatgg
ggaaaccatgacatcacttggattggggctatttctggttcctatatttgtatgattaat
gtgattagaattgccgcgcgctataatagcattgatttaattgaagaccgttatggtatt
aatttgcgtcgactcatagaatatagccaaagtcattttcaagaagaagatgtttttaat
cccattttggatggagaggaaattgctgatagtgaaagaatggttttgaatcaattgcaa
caagcgacagcactcctgcaatttaaattggagcatcaattgattaagagacggccttgt
tttgggatggaggctggtcttctattttcaaaaatagatacagaaaatcagacgattacc
ataggtgacataacataccccttacaatcatttccatttgagatgatggattgggacaat
cccgacggtttaacagaggaagaagaagctcttttgaaaggattaatgtatcgatttcag
aattcaactctcttaaaagagcatgttgactttttgattgaaaaaggaggcatgtatcat
atttccaataaccatctcttgtttcatggttgtatgccgatgcattcaaatggtgatttt
aaatccatggtttttggaaaacaagcttattctggcagagctttgcttgatttttttgaa
gagcaggttttggagtcctacaagaatccagatagtcatgaagattttcaaactgatatt
ttctggtatctgtggtgtggtgaagtgtcctcactttttggcaaagatcggatgacgacc
tttgaacgttattatattgcagataaaacgagtcatgtggaacataaaaatccctactat
aagttaagggaaaatgaagaaatttgtttgaggattttggaagagtttggattagataag
tccgcccatattgttaatggtcatacgccggttaaagaaaaaggtggggagctgcccatc
aaagccaatggtagaatgatcattattgatggtggtttggctaaaggctatcaaaaaaca
actggtattgctggatataccttaatttccaattcctatggtttggagttggtggcccat
aagcccttttcatctgttcaagatgttcttgaaggaaaatgcgacatcatttttatcaaa
cgattggttgaaattgtcgaaaaccggacactggtgaaagaaacagataatggtcagttg
cttttaaaagaaattgccgatctggaatacctttatcaccattttgatcaattttga

DBGET integrated database retrieval system