KEGG   Streptococcus uberis: SUB0733Help
Entry
SUB0733           CDS       T00849                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sub  Streptococcus uberis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sub00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sub00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708046..708975
Genome map
AA seq 309 aa AA seqDB search
MPVINNQVVLKHLVSMELLTNEEVLGLISRGSEFKAKNVPIANNSHYFTSNLFFENSTRT
HKSFEMAERHMGLQVVEFNTDTSSVNKGETLYDTILTMSALGVDICVVRHPEVDYYQSLI
KSPSITASIVNGGDGSGQHPSQCLLDLMTIYEEFGHFEGLKIMIAGDLVHSRVAKSNMQI
LKRLGAEIYFSGPDEWYSKEFEAYGEYRKIDDIIDQLDVLMLLRVQHERHNGSAGFSKEE
YHKNFGLTEERYEKLKDTAIIMHPAPVNRNAEIADSLVEAKKARIVAQMENGVYVRMAIL
EAILNGRSA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcatcaataatcaagttgttttaaagcatttagtgtcaatggaacttctaaca
aatgaggaggttctagggctcattagtcgtggttcggaatttaaagcgaaaaatgttcca
attgcaaacaatagtcactatttcacttcaaatctcttttttgaaaattctacacgaact
cataagtcatttgaaatggctgagcgacatatggggctacaggttgttgaatttaataca
gatacgagctctgtaaataaaggtgaaaccttatatgacactatcctaacaatgagtgct
ttgggtgttgatatctgtgtggtaagacatccagaagttgattattaccaatcacttata
aagagcccaagtattacagcgtctatcgtaaatggaggcgatggttctggtcaacaccct
agtcaatgtttacttgatttgatgacaatttatgaagaatttggtcattttgaaggtcta
aaaataatgattgctggagatttagtacattctcgtgtcgcaaaatccaatatgcaaatt
ttgaaacgtttaggtgcagagatttatttttctggtcctgatgaatggtattcaaaagaa
tttgaagcatatggcgaatatcgaaaaattgatgacattattgatcaattggacgtttta
atgttgttgcgtgtgcaacatgagagacacaatggctcagctggttttagtaaagaagag
tatcataaaaactttggtttgaccgaggaacggtacgaaaaattgaaagatacagcaatt
ataatgcatccagccccagttaaccgtaatgccgaaattgctgactccttagttgaagcg
aaaaaggcgagaattgttgctcaaatggaaaatggtgtttatgtccgtatggccatttta
gaagccatactaaatggtagatctgcctaa

DBGET integrated database retrieval system