KEGG   Streptococcus uberis: SUB0813Help
Entry
SUB0813           CDS       T00849                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sub  Streptococcus uberis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sub00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
793450..794010
Genome map
AA seq 186 aa AA seqDB search
MMDIKKAEDAIYQLLEAIGEDPQREGLLETPKRVAKMYEEMFSSLKSDAKEAFTAVFTEA
YDDLVLVKDIPFYSMCEHHLVPFYGVAHIAYYPQNGKVTGLSKLARAVEIASKKPQLQER
LTSQIADALDQSLHPRGVFVMVEAEHMCMTMRGIKKPGSKTMTTTARGIFTEDKKEQAYV
LSLIKD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatggatatcaaaaaagcagaagacgcaatataccaacttttagaagcaataggtgaa
gatccccagagagaaggcttactagagacaccaaagcgagttgccaaaatgtatgaggaa
atgttctcaagcttaaagtcagatgctaaagaagcttttacagcagtatttacagaggcc
tacgatgacctggttttggttaaagatattcctttttactcaatgtgtgaacaccattta
gttcctttctatggtgtagctcacattgcttattacccccaaaatggtaaagtaacggga
ttaagtaaattagcacgagcagtagaaattgcaagtaaaaagcctcaattacaagagcga
cttactagccaaattgctgatgccctagaccaatcacttcatccgcgtggcgtttttgtg
atggtggaagcagagcatatgtgcatgacgatgagaggcataaaaaaaccaggcagtaaa
acgatgacaaccacggccagaggcatctttacagaagataaaaaagaacaagcctatgtg
ttatcattaattaaagattag

DBGET integrated database retrieval system