KEGG   Streptococcus uberis: SUB1001Help
Entry
SUB1001           CDS       T00849                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sub  Streptococcus uberis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUB1001 (pfk)
   01230 Biosynthesis of amino acids
    SUB1001 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB1001 (pfk)
   00030 Pentose phosphate pathway
    SUB1001 (pfk)
   00051 Fructose and mannose metabolism
    SUB1001 (pfk)
   00052 Galactose metabolism
    SUB1001 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SUB1001 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SUB1001 (pfk)
Enzymes [BR:sub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SUB1001 (pfk)
Protein phosphatases and associated proteins [BR:sub01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SUB1001 (pfk)
Messenger RNA biogenesis [BR:sub03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SUB1001 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(977321..978334)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGVNHGYAGLVAGDIFPISSKGVGDK
ISRGGTFLYSARYPEFANLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFNIQQVVKTIDDDFKKQGKNHHIIVLAEGVMSGDQFAQELKAAGN
TSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKQGKGGFAVGIHNEELVESPILG
SAEEGALFSLGEDGKIIVNNPHRARLDFAKLNRSLSR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggtggtgatgcccctggtatgaatgctgcgatt
agagcggttgttcgtaaagcaatctcagaaggaatggaagtttacggagtaaaccatggt
tatgctggtttagttgccggagatattttcccaattagctctaaaggtgttggtgacaaa
atttctcgtggtggaactttcttatattctgctcgctatcctgaatttgctaatttagaa
ggacaattagcaggtattgaacaacttaaaaaacatggcattgaaggtgttgttgttatt
gggggagatggttcttatcatggagctatgagactaactgagcatggtttccctgcagtt
ggtatcccaggaacaatcgataacgatattgctggtacagattacactatcggatttgat
actgcagttaatactgctgttgaagcaattgataaattgcgtgatacttcttcaagtcat
ggacgtacatttgttgttgaagttatgggacgtaacgctggtgatattgctctttgggca
ggtattgcaagtggtgcagaccaaattatcgtacctgaagaagaattcaatatccaacaa
gttgtcaaaacaatcgatgatgatttcaaaaaacaaggtaaaaatcaccacatcattgtt
ttagctgaaggtgttatgagtggtgaccaatttgctcaagaattaaaagcagctggaaat
acaagtgatctccgtgtgacaaaccttggacatattctacgtggtggttcaccaactgca
cgtgaccgtgttattgcatcttggatgggatcacacgctgttgaattacttaaacaaggt
aaaggtggttttgcagttggtattcataatgaagaacttgttgaaagtccaattttaggt
agtgcagaagaaggtgctttattctcattgggtgaagatggtaaaatcatcgttaacaat
ccacatagagcacgtcttgatttcgctaaattaaatcgttcactttcaagataa

DBGET integrated database retrieval system