KEGG   Streptococcus uberis: SUB1001Help
Entry
SUB1001           CDS       T00849                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sub  Streptococcus uberis
Pathway
sub00010  Glycolysis / Gluconeogenesis
sub00030  Pentose phosphate pathway
sub00051  Fructose and mannose metabolism
sub00052  Galactose metabolism
sub00680  Methane metabolism
sub01100  Metabolic pathways
sub01110  Biosynthesis of secondary metabolites
sub01120  Microbial metabolism in diverse environments
sub01130  Biosynthesis of antibiotics
sub01200  Carbon metabolism
sub01230  Biosynthesis of amino acids
sub03018  RNA degradation
Module
sub_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB1001 (pfk)
   00030 Pentose phosphate pathway
    SUB1001 (pfk)
   00051 Fructose and mannose metabolism
    SUB1001 (pfk)
   00052 Galactose metabolism
    SUB1001 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SUB1001 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SUB1001 (pfk)
Enzymes [BR:sub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SUB1001 (pfk)
Protein phosphatases and associated proteins [BR:sub01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SUB1001 (pfk)
Messenger RNA biogenesis [BR:sub03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SUB1001 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CAR42233
UniProt: B9DSA4
Position
complement(977321..978334)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGVNHGYAGLVAGDIFPISSKGVGDK
ISRGGTFLYSARYPEFANLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFNIQQVVKTIDDDFKKQGKNHHIIVLAEGVMSGDQFAQELKAAGN
TSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKQGKGGFAVGIHNEELVESPILG
SAEEGALFSLGEDGKIIVNNPHRARLDFAKLNRSLSR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggtggtgatgcccctggtatgaatgctgcgatt
agagcggttgttcgtaaagcaatctcagaaggaatggaagtttacggagtaaaccatggt
tatgctggtttagttgccggagatattttcccaattagctctaaaggtgttggtgacaaa
atttctcgtggtggaactttcttatattctgctcgctatcctgaatttgctaatttagaa
ggacaattagcaggtattgaacaacttaaaaaacatggcattgaaggtgttgttgttatt
gggggagatggttcttatcatggagctatgagactaactgagcatggtttccctgcagtt
ggtatcccaggaacaatcgataacgatattgctggtacagattacactatcggatttgat
actgcagttaatactgctgttgaagcaattgataaattgcgtgatacttcttcaagtcat
ggacgtacatttgttgttgaagttatgggacgtaacgctggtgatattgctctttgggca
ggtattgcaagtggtgcagaccaaattatcgtacctgaagaagaattcaatatccaacaa
gttgtcaaaacaatcgatgatgatttcaaaaaacaaggtaaaaatcaccacatcattgtt
ttagctgaaggtgttatgagtggtgaccaatttgctcaagaattaaaagcagctggaaat
acaagtgatctccgtgtgacaaaccttggacatattctacgtggtggttcaccaactgca
cgtgaccgtgttattgcatcttggatgggatcacacgctgttgaattacttaaacaaggt
aaaggtggttttgcagttggtattcataatgaagaacttgttgaaagtccaattttaggt
agtgcagaagaaggtgctttattctcattgggtgaagatggtaaaatcatcgttaacaat
ccacatagagcacgtcttgatttcgctaaattaaatcgttcactttcaagataa

DBGET integrated database retrieval system