KEGG   Streptococcus uberis: SUB1076Help
Entry
SUB1076           CDS       T00849                                 

Definition
(RefSeq) zinc-binding alcohol dehydrogenase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sub  Streptococcus uberis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SUB1076
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB1076
  Lipid metabolism
   00071 Fatty acid degradation
    SUB1076
  Amino acid metabolism
   00350 Tyrosine metabolism
    SUB1076
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SUB1076
   00626 Naphthalene degradation
    SUB1076
Enzymes [BR:sub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SUB1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048090..1049130)
Genome map
AA seq 346 aa AA seqDB search
MKAATFIEPGKMVITEREKPIIEAPTDAIIKIVRACVCGSDLWWYRGISQRETGSYAGHE
AIGIVESVGEAVTNVQAGDFVIVPFTHGCGQCAACKAGFDGNCTNHLPGKKIGYQAEYLR
YTNADWALVKVPGQPSDYSDDKLNSLLTLSDVMATGYHAAKTAEVKEGDTVVVMGDGAVG
LCGVIAAKLLGAKRIIAMSRHKDRQELALEFGATDIIAERGDDAVEKVMALTNQEGVDAI
LECVGTEQSVDTAVKIARPGAIVGRVGIPQNPEMNTNNLFWKNIGLRGGIASVTTFDKEV
LLEAVLSDKINPGKVFTKSFTLDDIQLAYEAMDKREAIKSLVLISD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaacatttatagagccaggaaaaatggtgattacggaacgtgaaaaaccc
attattgaagcaccaacggatgctattattaaaattgtcagagcttgtgtctgtggttct
gatttatggtggtatcgtggtatttctcaaagggaaacgggttcttatgccggtcatgaa
gcaataggtattgttgaatcagtgggagaagcagtcactaatgttcaagcaggagatttt
gtcattgttcccttcacacatggttgtggccagtgcgcagcttgtaaggctggttttgac
gggaactgtaccaatcatttaccaggtaaaaagattggttatcaagctgaataccttcgc
tataccaatgcggattgggctttggttaaagttccaggtcaaccatcagattatagtgat
gacaaattgaactcactcctaaccttatcagatgtgatggcaacgggttatcatgctgcc
aaaacagcagaagtcaaggaaggtgacaccgtcgttgttatgggggacggggctgtaggc
ctctgtggcgttatagctgctaaattattaggggctaaacgcatcatcgctatgagccgt
cataaagatcgccaagaactagcccttgaatttggagctactgatattattgctgaacgt
ggagatgacgctgttgaaaaagtaatggctttgactaatcaagaaggggttgatgccatt
ttagaatgtgttgggacagaacaatctgttgacaccgcagtcaaaattgctagaccaggg
gcaatagttggtcgtgtgggaatcccacaaaatccagaaatgaataccaacaatctcttc
tggaaaaatattggcttacgtggtggaattgcttcggttacaacctttgataaagaggtc
ttgcttgaagcagttttgagcgacaaaatcaatccaggcaaagtttttaccaaatccttt
actttggatgacattcaattagcctatgaagccatggataaacgtgaagctattaagtca
ttagttcttatcagtgattaa

DBGET integrated database retrieval system