KEGG   Streptococcus uberis: SUB1076Help
Entry
SUB1076           CDS       T00849                                 

Definition
(GenBank) putative zinc-binding alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sub  Streptococcus uberis
Pathway
sub00010  Glycolysis / Gluconeogenesis
sub00071  Fatty acid degradation
sub00350  Tyrosine metabolism
sub00625  Chloroalkane and chloroalkene degradation
sub00626  Naphthalene degradation
sub01100  Metabolic pathways
sub01110  Biosynthesis of secondary metabolites
sub01120  Microbial metabolism in diverse environments
sub01130  Biosynthesis of antibiotics
sub01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB1076
  Lipid metabolism
   00071 Fatty acid degradation
    SUB1076
  Amino acid metabolism
   00350 Tyrosine metabolism
    SUB1076
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SUB1076
   00626 Naphthalene degradation
    SUB1076
Enzymes [BR:sub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SUB1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 PALP AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CAR42378
UniProt: B9DSD4
Position
complement(1048090..1049130)
Genome map
AA seq 346 aa AA seqDB search
MKAATFIEPGKMVITEREKPIIEAPTDAIIKIVRACVCGSDLWWYRGISQRETGSYAGHE
AIGIVESVGEAVTNVQAGDFVIVPFTHGCGQCAACKAGFDGNCTNHLPGKKIGYQAEYLR
YTNADWALVKVPGQPSDYSDDKLNSLLTLSDVMATGYHAAKTAEVKEGDTVVVMGDGAVG
LCGVIAAKLLGAKRIIAMSRHKDRQELALEFGATDIIAERGDDAVEKVMALTNQEGVDAI
LECVGTEQSVDTAVKIARPGAIVGRVGIPQNPEMNTNNLFWKNIGLRGGIASVTTFDKEV
LLEAVLSDKINPGKVFTKSFTLDDIQLAYEAMDKREAIKSLVLISD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaacatttatagagccaggaaaaatggtgattacggaacgtgaaaaaccc
attattgaagcaccaacggatgctattattaaaattgtcagagcttgtgtctgtggttct
gatttatggtggtatcgtggtatttctcaaagggaaacgggttcttatgccggtcatgaa
gcaataggtattgttgaatcagtgggagaagcagtcactaatgttcaagcaggagatttt
gtcattgttcccttcacacatggttgtggccagtgcgcagcttgtaaggctggttttgac
gggaactgtaccaatcatttaccaggtaaaaagattggttatcaagctgaataccttcgc
tataccaatgcggattgggctttggttaaagttccaggtcaaccatcagattatagtgat
gacaaattgaactcactcctaaccttatcagatgtgatggcaacgggttatcatgctgcc
aaaacagcagaagtcaaggaaggtgacaccgtcgttgttatgggggacggggctgtaggc
ctctgtggcgttatagctgctaaattattaggggctaaacgcatcatcgctatgagccgt
cataaagatcgccaagaactagcccttgaatttggagctactgatattattgctgaacgt
ggagatgacgctgttgaaaaagtaatggctttgactaatcaagaaggggttgatgccatt
ttagaatgtgttgggacagaacaatctgttgacaccgcagtcaaaattgctagaccaggg
gcaatagttggtcgtgtgggaatcccacaaaatccagaaatgaataccaacaatctcttc
tggaaaaatattggcttacgtggtggaattgcttcggttacaacctttgataaagaggtc
ttgcttgaagcagttttgagcgacaaaatcaatccaggcaaagtttttaccaaatccttt
actttggatgacattcaattagcctatgaagccatggataaacgtgaagctattaagtca
ttagttcttatcagtgattaa

DBGET integrated database retrieval system