KEGG   Streptococcus uberis: SUB1101Help
Entry
SUB1101           CDS       T00849                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sub  Streptococcus uberis
Pathway
sub00010  Glycolysis / Gluconeogenesis
sub00020  Citrate cycle (TCA cycle)
sub00620  Pyruvate metabolism
sub01100  Metabolic pathways
sub01110  Biosynthesis of secondary metabolites
sub01120  Microbial metabolism in diverse environments
sub01130  Biosynthesis of antibiotics
sub01200  Carbon metabolism
Module
sub_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB1101 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SUB1101 (pdhC)
   00620 Pyruvate metabolism
    SUB1101 (pdhC)
Enzymes [BR:sub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SUB1101 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B
Motif
Other DBs
NCBI-ProteinID: CAR42427
UniProt: B9DSF8
Position
complement(1073372..1074787)
Genome map
AA seq 471 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDVLLEINSDKTNMEIEAEDSGVLLKII
RQEGDVVPVTEVIGYIGAEGESVDNIASSEKTSEIPAPQSADAAPSVAPKEDVERPALAV
AQTALPQGDGSPVRATPAARKAAKEMGLSLGQIPGSGPKGRVHVEDVENFKNAQPKASPL
ARKMAADAGLDLASISGTGFKGKVMKEDILAAIEASKPAQAAAEKPAKEEKAKAELPEGV
EIIKMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMEKTGLKVSFTD
LIGMAVVKTLMKPEHRYMNASLINDAQEIELHKFVNIGIAVGLDDGLIVPVVHNADKMTL
ADFVVASKDVIKKTQAGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGIGATI
PTPTVVDGEIVPRPIMAMCLTIDHRLVDGMNGAKFMVDLKNLMENPFGLLI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgaaatcattatgcccaaactcggtgtagacatgcaagaaggcgaaatcatc
gagtggaaaaaacaagaaggtgacactgtaaacgaaggtgacgtcctccttgaaattaat
tctgacaaaacaaacatggaaatcgaagcggaagattctggtgtcctccttaaaatcatc
cgtcaagaaggtgatgtggttcctgtaacagaagttattggttacatcggtgcagaaggt
gaatccgttgacaacattgcttcaagcgaaaaaacaagtgaaatccctgcaccacaatct
gcagacgcagcaccatcagtagcaccaaaagaagatgtcgaaagaccagctcttgctgtt
gcgcaaacagctcttcctcaaggtgacggttctccagttcgtgccacaccagctgctcgc
aaagctgcaaaagaaatgggacttagccttggtcaaatcccaggttcaggaccaaaaggt
cgtgtacatgttgaagacgttgaaaacttcaaaaatgcacaacctaaagcatcaccactt
gctcgtaaaatggctgcagatgcaggtcttgacctagcatccatttcaggaacaggcttc
aaaggcaaagttatgaaagaagatatccttgctgccatcgaagcaagcaagcctgcccaa
gctgcagcagaaaaacctgctaaagaagaaaaagctaaagcagaattacctgaaggtgtg
gaaatcattaagatgtctgcaatgcgtaaagccatttctaaaggtatgaccaactcttac
ttaacggcacctacattcacgcttaactatgacatcgacatgacagagatgattgccctt
cgtaagaaattaattgatccaatcatggaaaaaactggcttgaaagtcagcttcactgat
ttgatcggtatggcagtcgttaaaaccttgatgaaacctgagcaccgttacatgaatgct
tcattaatcaatgatgctcaagaaattgaattgcacaaattcgtcaatattggtattgcc
gtaggattagatgatggattgattgtaccagttgttcacaatgcagataagatgacacta
gcagactttgtggtcgcttcaaaagatgttatcaagaaaacacaagctggtaagctaaaa
gctgcagaaatgtctggttcaacattctcaatcaccaaccttggtatgtttggaacaaaa
acctttaacccaattatcaaccaaccaaactcagcaatcttgggtattggtgcaaccatt
ccaacaccaacagtagttgatggtgaaattgtgcctcgtccaatcatggcaatgtgcttg
accattgaccaccgtttagttgacggtatgaatggtgctaaattcatggttgaccttaaa
aacttaatggaaaacccatttggtttgttaatctaa

DBGET integrated database retrieval system