KEGG   Streptococcus uberis: SUB1141Help
Entry
SUB1141           CDS       T00849                                 

Gene name
malM
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sub  Streptococcus uberis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SUB1141 (malM)
Enzymes [BR:sub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SUB1141 (malM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1115246..1116754)
Genome map
AA seq 502 aa AA seqDB search
MNNRASGILMHISSLPGQFGIGTFGKFAYDFVDFLKESKQTYWQILPLTTTSFGDSPYQS
FSAIAGNTHFIDFEELEQNGYLEKSDYQGISFGNNPESVDYALIFKERRPILEKAVSTFL
KKPEGLKALAQFEERASWVKDFAEFMAIKEHFGNKALQEWDDESIIKRDEKALETYRERL
SDQINYHKVCQYFFFEQWSALKAYANKNGIDIIGDMPIYVSADSVEVWTMPELFKVDSHK
KPLYIAGVPADGFSEDGQLWGNPIYNWENHEKTDFAWWVYRIQESCKLYDKVRIDHFKGF
SDFWEIPGGDTTARNGRWQSAPGFELFETVRKELGELPIIAENLGYIDEKAERLLASTGF
PGMKILEFGLYDETSQSFDLPHNYETNSVVYTGTHDNEVVNGWYENLTVKQAQFVDAYLN
RSHEESITEAMLRTIFASVGDIAILCMQDLLDKDADSRMNMPNTVGGNWQWRMLENDLTP
AHKDYLVYLTELYGRVNQKELH
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcgtgcaagtggaattttaatgcatatcagctcattacctggtcaatttggt
attggtacatttggtaagtttgcatatgatttcgtcgactttctgaaagaaagcaaacaa
acttattggcaaatactacctctaacaaccacaagttttggagattcaccttatcaatct
ttttcagcaatagctggaaatacccattttattgatttcgaagaacttgaacaaaatggt
tacttagaaaaaagtgattaccaagggatttcatttggcaataatcccgaaagtgtcgat
tatgccttaatttttaaagaacgtcgcccaatcttggaaaaagctgtatcaacctttttg
aaaaaaccagagggtcttaaggcattagctcaatttgaagaaagagcaagctgggttaaa
gattttgcagagtttatggccattaaagaacattttggtaacaaagcactacaagagtgg
gatgatgaatccattattaaaagagatgaaaaagctttggaaacttatcgtgaaagattg
agtgatcagataaattatcataaagtttgtcaatatttcttttttgaacagtggtctgcc
ttaaaagcttatgccaataaaaatggtattgatattattggtgatatgcctatctatgtt
tcggctgatagtgtagaagtttggaccatgccagaattatttaaagtagacagtcataaa
aaaccactttatattgctggcgttccagcggatggtttcagtgaagatggccaactttgg
ggcaatcctatttacaattgggaaaatcacgaaaaaacagattttgcatggtgggtttat
cgcattcaagaatcatgcaaactgtatgataaagttcgaattgaccattttaaaggattt
tctgatttctgggaaattcctgggggagatacaactgcaagaaatggccgttggcaatca
gctcctggcttcgaactatttgaaaccgttcgtaaagaattaggagaactgcctattatt
gctgaaaacttaggttatattgatgagaaagcagagcgtcttcttgcttcgactggtttc
ccaggaatgaaaatacttgaatttggtttatatgatgaaacgagtcaaagctttgattta
ccacataattatgaaacaaatagtgtcgtttacacaggaactcatgataatgaagtagtt
aacggttggtatgaaaaccttacggttaaacaagctcaattcgtggatgcatacctcaat
agatctcatgaggagtctattacagaagctatgcttcgaaccatttttgcatccgtagga
gatatagctattttatgtatgcaagatttgcttgataaagacgctgactctcgcatgaat
atgccaaatacagttggaggcaattggcaatggcgtatgcttgaaaatgacttaactcca
gcccataaagactatttagtttatctaacggaattgtatggccgtgttaatcagaaagag
ttacattaa

DBGET integrated database retrieval system