KEGG   Streptococcus uberis: SUB1298Help
Entry
SUB1298           CDS       T00849                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sub  Streptococcus uberis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUB1298 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUB1298 (glkA)
   00052 Galactose metabolism
    SUB1298 (glkA)
   00500 Starch and sucrose metabolism
    SUB1298 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SUB1298 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SUB1298 (glkA)
   00524 Butirosin and neomycin biosynthesis
    SUB1298 (glkA)
Enzymes [BR:sub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SUB1298 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1285700..1286671)
Genome map
AA seq 323 aa AA seqDB search
MSHKLLGIDLGGTTIKFGILTLEGEVQEKWAIQTNILENGMHIVPDIVASIKHRLEMYGL
SKDDFVGIGMGSPGAVDRTQNTVTGAFNLNWKDTQEVGSVIESELGIPFAIDNDANVAAL
GERWVGAGDNNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPMNGFACTCG
SYGCLETVASATGVVKVARLLAESYEGSSAIKAAIDNGEEVTSKDIFVAAEAGDTFADSV
VEKVAFYLGLASANISNILNPDSLVIGGGVSAAGEFLRSRIERYFMTYTFPQVKASTKIK
IAELGNDAGIIGAASLARQFIKE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataaattattaggaattgatcttggtggaacaaccattaaatttggaatatta
acacttgaaggtgaagtgcaggaaaaatgggccatccaaacgaatattttggaaaacgga
atgcatattgtccctgacattgttgcctcaattaaacatcgtttagagatgtatgggtta
tctaaagacgattttgtcggaatcggcatgggttccccaggtgctgttgaccggacccaa
aacacagtcacaggtgcttttaatttgaactggaaagacactcaagaagttggttctgtg
attgaaagcgaacttggtattccatttgccattgataatgatgccaacgtagctgcgctt
ggagaacgatgggtaggtgccggtgataataacccagatgttgtctttatgacgctaggt
actggtgtcggcggtggtatcatagcggatggaaatctcattcatggtgtagccggagca
ggtggcgaaattggtcacatgattgtggaaccaatgaatggttttgcttgtacttgtggt
tcttacggttgtttagaaacagttgcttctgctactggagtagtgaaagtggctcgactc
ttagctgaaagttatgaaggtagttcggcaattaaggccgcaattgataacggtgaagag
gtaacaagtaaagacatttttgtggctgctgaagcgggggatacttttgcagattctgtt
gttgaaaaagtggctttttatcttggactagcatcagcaaatatttcaaatatcctaaat
ccagattctcttgtcattggtggtggcgtctctgcagcaggtgaatttttaaggtccaga
attgaacgttattttatgacttatactttcccacaagtaaaagcttcaaccaaaataaaa
attgcagaacttggcaatgacgctggtattattggtgcagctagtcttgcacgtcagttc
attaaagaatag

DBGET integrated database retrieval system