KEGG   Streptococcus uberis: SUB1394Help
Entry
SUB1394           CDS       T00849                                 

Gene name
atoB2
Definition
(GenBank) acetyl-CoA acetyltransferase 2
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sub  Streptococcus uberis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SUB1394 (atoB2)
   00630 Glyoxylate and dicarboxylate metabolism
    SUB1394 (atoB2)
   00640 Propanoate metabolism
    SUB1394 (atoB2)
   00650 Butanoate metabolism
    SUB1394 (atoB2)
  Lipid metabolism
   00071 Fatty acid degradation
    SUB1394 (atoB2)
   00072 Synthesis and degradation of ketone bodies
    SUB1394 (atoB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SUB1394 (atoB2)
   00310 Lysine degradation
    SUB1394 (atoB2)
   00380 Tryptophan metabolism
    SUB1394 (atoB2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SUB1394 (atoB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SUB1394 (atoB2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SUB1394 (atoB2)
Enzymes [BR:sub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SUB1394 (atoB2)
Exosome [BR:sub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SUB1394 (atoB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1391827..1393014
Genome map
AA seq 395 aa AA seqDB search
MDKVVIVQALRTPIGAFGGAFKDVNAVTLATTVIKKMLDNTQLPPHHIDEVIIGNVLHAG
LGQNIARQIAIHSGIPNEKTAFTVDMVCGSGLKAIQLAAQSILLGDAKIIIAGGVENMSQ
APYVCQSNRFGSRLGNSELIDTLVHDGLTDAFSKTHMGITAENVAKNYQISREEQDQFAF
NSQQKAAEALKNNRFKEEIVPVTVTQRKGDPLIVSQDEYPKPNSSLEKLKKLRPAFMSSE
GTVTAGNASGINDGAAMVMLMTEKHAKQLGLEILASITSYASAGVDPDIMGTGPIPATQK
ALEKANLKISDIGLIESNEAFAAQSLAVMMSLECQADKVNVNGGAIALGHPIGASGARIL
VTLLHEMKKQDVTNGLATLCIGGGQGTSLIVTQEK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtcgttattgtccaagctctaagaacaccaattggtgcattcggaggagct
tttaaagatgttaatgccgttacattagctaccactgttataaaaaaaatgttggataat
acccagctccctcctcatcacattgatgaggttattattggcaatgttcttcatgcaggt
ctcggccaaaatatcgcccgtcaaattgccattcactccggaattccaaacgaaaaaaca
gcttttacagttgatatggtttgtggttctggtctaaaagcaatacaattagcagcccag
agtattttattaggtgatgcgaaaatcattatagcaggtggcgtcgaaaacatgtcccaa
gcaccctacgtttgtcaaagtaaccgatttggcagtcgactgggaaatagtgaattaatc
gatacacttgttcacgatgggttaacggatgcctttagtaaaacccatatggggattaca
gctgaaaacgttgcaaaaaattaccaaattagtagagaagaacaagatcagtttgcattc
aatagtcaacaaaaggcagctgaagcacttaaaaataatcgtttcaaagaagaaattgtt
ccagttacagtaactcaaagaaaaggagaccctttaatcgtctcacaagatgagtatcca
aaaccaaattcgagtttagagaaactcaaaaaattaagaccagcatttatgtcttctgaa
gggactgttacagctggaaatgcctcaggcattaatgatggtgctgcaatggtcatgtta
atgactgaaaaacatgctaaacaattaggtttagagattttggcttctatcacttcctac
gctagtgcaggtgttgatcctgatattatgggaacaggaccaatcccagcaactcaaaaa
gccttagaaaaagccaatttaaaaatatctgatattggcttaattgaatcaaacgaggca
tttgctgctcaatctctcgccgtaatgatgtcattagaatgtcaagcagacaaggttaat
gttaatggtggtgcaattgcattagggcacccaattggtgcaagtggagctcgtattctt
gtcaccttacttcatgaaatgaaaaaacaagatgtaacaaatggattagcaaccctttgt
atcggaggcggacaaggaacaagtctgatcgtaactcaggaaaagtaa

DBGET integrated database retrieval system