KEGG   Streptococcus uberis: SUB1565Help
Entry
SUB1565           CDS       T00849                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sub  Streptococcus uberis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sub00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SUB1565
Enzymes [BR:sub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SUB1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1555192..1557615
Genome map
AA seq 807 aa AA seqDB search
MEHYFTGTIDRIIYENASNFFKILLLSIEDTDSDIDDFEIIITGTMADVFEGEDYTFWGE
LTQHPKYGQQVKLTRYQKAKPTSSGLIKYFSSDHFKGIGKKTAEKIVSLYGDNTIDKILE
DPSQLETITGFSKANREAFLATLKLNYGTEQIISSLVELGISNRLAFLIYDCYKEEALET
VKTNPYQLVEDIQGIGFKMADTLAFEIGIKSDAPERFRAALLHSLLEKSISQGDTYIEAR
DLLEYAINLLEDSRPIECQPAQVAEQLSQLIADSKIYHIGTKLFDATLYASEAGIHKHIS
RLLETPLSQPHSEESIDEEIQSIEASFNMTYDRIQKEAIKLALSSKVFILTGGPGTGKTT
VIRGILEAYSSLNKIDLEKKDLPILLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMDDYLDCDLIIIDEFSMVDTWLANQLLSSLPSSTQVIIVGDSDQLPSVGPGQVLADLL
KVPSIPKIALQKIFRQSEDSTIVDLANQMRLGHLPRDFKEKKADRSFFEAYAQHIPTMVT
KIVTSAINSGIPKEEIQILAPMYKGQAGINHLNQLMQDLLNPLGDGQEFLFNDIHLRRGD
KILHLVNDAQLNVFNGDIGYIRDLIPAKYTESKQDEIIMDFDGTEVTYPRNEWLKITLAY
AMSIHKSQGSEFQVVILPITHQGGRLLQRNLIYTAVTRSKSKLILLGEYSAFHYAIQKEG
DKRQTYLVQRFADSSLTETLDNDSGDDHLQNAQLSPQKITNDVQYLPIKDSGPQEEEAYR
LTLENMLSIDPMIGLKEEDILIFFNKN
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atggagcactatttcactggaacaatcgaccgcattatctacgagaacgccagtaatttt
tttaaaatccttctcttatctattgaagatacggacagtgacattgatgattttgaaatt
attatcactggtacaatggctgatgtttttgaaggagaagattacacgttttggggcgaa
ttaactcaacaccctaaatacggccaacaagtaaaattaaccagataccaaaaagcaaaa
ccgacgtcgtctggcctaattaagtacttttccagtgaccattttaaagggattggaaaa
aagacagcagaaaaaattgtctctttatacggagacaacaccattgataaaattctagaa
gaccctagtcaattagagaccataacaggattttcgaaggccaatagagaagcctttctg
gcaacattaaagctaaattacggaacggaacaaattatttcatcccttgttgaacttggc
atttcaaatcgtcttgccttcttaatctatgattgctacaaggaagaagccttagaaact
gtcaaaaccaacccctatcaacttgtagaagacattcaaggaattggctttaaaatggct
gatacacttgcctttgaaattggaatcaaaagtgatgctcccgaacgcttccgtgcagca
ctcttacattcacttttagaaaaatccatcagtcaaggagatacttatatagaagcgcgt
gatctcctagaatatgccattaatctcttagaagattcgagaccaattgaatgtcaaccc
gcccaagtggctgaacaattaagtcaattgattgctgattcaaaaatttatcatattgga
acaaaactctttgatgccaccctttacgcatctgaagcaggcattcataagcatatttca
cgtcttttagaaaccccattatcgcagcctcattctgaggaatccattgatgaagaaatc
cagtcaatagaagcttctttcaatatgacttatgataggattcaaaaagaagccataaaa
ctagcactttccagtaaagtttttatcttaacaggaggacccggtactggaaaaacaact
gtgattagaggtattctcgaggcctattcctccttaaacaagattgatcttgaaaaaaaa
gatcttccaatcctcttagctgcgccaactggcagagcagctagacgaatgaatgagttg
actggtttacctagcgccaccattcaccgacatttgggcctaaacggggataacgattac
caagcaatggatgattatttagactgtgatttaatcattatcgatgaattttccatggtt
gatacttggcttgccaaccaactcctaagctctttaccatcaagcacacaagttatcatt
gtgggcgacagtgaccaacttccctctgtcggaccaggacaagtactagccgatttgcta
aaagttccaagcattccaaaaattgcccttcaaaagatttttaggcaatccgaagattct
accattgtcgatttagccaatcaaatgagactgggacatttgccaagggactttaaagaa
aaaaaagccgatcgctcattttttgaagcttacgcccaacatattccaacaatggtgaca
aaaatagtaacttctgctataaatagcggaattccaaaagaagaaattcaaattttggca
cccatgtacaaaggccaagccggaattaaccatttaaatcaattaatgcaagatctcctt
aacccacttggtgatggacaagagtttctctttaacgatatacatttaaggaggggagat
aagattctccacttggtcaatgatgcccaattaaatgtttttaatggcgatattggatat
attagagacttgattccagcaaaatacactgaatcaaaacaagatgaaattatcatggac
tttgatggaactgaagttacttacccaagaaatgaatggctgaaaatcacccttgcttat
gccatgagtatccataaatcacaaggaagtgaatttcaagtggttattttaccaatcacg
catcaaggggggcggctgttacaacgcaatcttatctatacagctgtcacgcgctccaag
agcaaacttatcctacttggagaatattcagcctttcattatgctatccaaaaagaagga
gataagcgtcaaacttatttggtgcaacgctttgctgatagctcactaacagaaactcta
gataatgactcaggtgacgaccaccttcaaaatgctcagctttcgcctcaaaaaattacg
aatgacgtccaatacctaccaatcaaggactcaggtcctcaagaagaagaggcctatcgc
ttgaccctcgaaaatatgttaagcattgatcctatgattggtctcaaagaagaggacatt
ctcatcttttttaataaaaattaa

DBGET integrated database retrieval system