KEGG   Streptococcus uberis: SUB1692Help
Entry
SUB1692           CDS       T00849                                 

Gene name
hasC
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sub  Streptococcus uberis
Pathway
sub00040  Pentose and glucuronate interconversions
sub00052  Galactose metabolism
sub00500  Starch and sucrose metabolism
sub00520  Amino sugar and nucleotide sugar metabolism
sub01100  Metabolic pathways
sub01130  Biosynthesis of antibiotics
Module
sub_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SUB1692 (hasC)
   00052 Galactose metabolism
    SUB1692 (hasC)
   00500 Starch and sucrose metabolism
    SUB1692 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    SUB1692 (hasC)
Enzymes [BR:sub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SUB1692 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: CAR43603
UniProt: B9DVY0
Position
1671792..1672706
Genome map
AA seq 304 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEEILVVTGKS
KRSIEDHFDSNFELEYNLQEKGKTELLKLVDETTSINLHFIRQSHPKGLGDAVLQAKAFV
GNEPFIVMLGDDLMDITNTKAVPLTKQLMDDYETTHASTIAVMKVPHDDVSSYGVIAPNG
KALNGLYSVDTFVEKPKPEDAPSDLAIIGRYLLTPEIFDILENQAPGAGNEVQLTDAIDT
LNKTQRVFAREFTGKRYDVGDKFGFMKTSIDYALKHHQVKDDLKAYIIKLGKELEKAQDS
KESK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagtaagaaaagccattattccagctgccggacttggcacacgttttttacca
gcaacaaaagctctcgctaaggaaatgttgcccatcgttgacaaaccaaccattcaattc
atcgtggaagaagctttgcgttctggcattgaagaaatcttggtcgtaacaggaaaatca
aaacgctccattgaagaccattttgattccaactttgaactcgaatataatttgcaagaa
aaagggaaaactgaactcttaaaattagttgatgaaaccacttctataaacttgcatttc
attcgtcaaagtcatcccaaaggcttaggggatgctgttttacaagcaaaagcttttgta
ggaaatgaacccttcattgttatgcttggtgacgatttgatggacattacaaataccaaa
gctgtcccattaaccaaacaattaatggacgattatgaaacaacacatgcttctacaata
gccgtaatgaaagttcctcacgatgacgtatcctcttatggtgtcattgctccaaacggc
aaagccttgaatggcttatatagcgtggatacctttgttgaaaaaccaaaacctgaggac
gcaccaagtgaccttgctatcattggacgttatctcttaacacctgaaatttttgacatt
cttgaaaatcaagcaccaggtgccggaaacgaagtccaattaactgatgctatcgatacc
ctcaacaaaacacaacgtgtttttgctcgtgagtttactggcaaacgctacgatgttgga
gacaagtttggcttcatgaaaacatctatcgattatgccctaaaacaccatcaagtcaaa
gatgacctaaaagcttatattatcaagttaggtaaagaattagaaaaagcacaagattcc
aaagaaagcaaataa

DBGET integrated database retrieval system