KEGG   Streptococcus uberis: SUB1781Help
Entry
SUB1781           CDS       T00849                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sub  Streptococcus uberis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sub00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SUB1781 (ruvA)
Enzymes [BR:sub01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SUB1781 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1767353..1767946)
Genome map
AA seq 197 aa AA seqDB search
MFDYIKGQLTKITAKYIVVEANGLGYIIYVANPYSFSDSVNQTLTIYLHQVIREDAHLLF
GFHTENEKDVFLKLISVSGIGPMTALAIVAVDDNEGLVAAIDNSDIKYLMKFPKIGKKTA
QQMILDLSGKFVTIPEGGQAQQMPKAKGNQQLDEAIEALLALGYKATELKKIRAFFEGTD
DTAEQYIKSALKMLMKG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattatatcaaaggtcaattaacaaaaattacagcaaaatatatcgtcgttgaa
gcaaacggattaggctatattatttatgtcgctaatccctatagtttctcggatagtgtc
aatcagacgcttacaatctaccttcatcaagttattcgtgaagacgcacatctccttttt
gggtttcacacagaaaatgaaaaagatgtttttctaaagttgatttcagtttcaggaatt
ggtccaatgactgccttagcaattgttgcagttgatgacaacgaaggattagtggcagca
atcgataatagcgatatcaaatatttaatgaaatttccgaaaattggaaagaaaaccgca
caacaaatgatattggatttatcaggtaaatttgtaaccattcctgaaggcggacaagct
cagcaaatgccaaaagccaagggtaaccaacaacttgacgaggcaatcgaagccctttta
gcattaggatataaagcaaccgagcttaaaaaaatccgtgccttttttgaaggaacagat
gataccgcagagcaatacatcaaatcggctcttaagatgcttatgaaaggctaa

DBGET integrated database retrieval system