KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_1227Help
Entry
ECTR2_1227        CDS       T01887                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase (IGPS)
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
suc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
suc01100  Metabolic pathways
suc01110  Biosynthesis of secondary metabolites
suc01130  Biosynthesis of antibiotics
suc01230  Biosynthesis of amino acids
Module
suc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECTR2_1227
Enzymes [BR:suc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ECTR2_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh BBE His_biosynth
Motif
Other DBs
NCBI-ProteinID: CBX34607
Position
1333997..1334779
Genome map
AA seq 260 aa AA seqDB search
MTILAEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPT
VNDLPERDLSQQISDYEKYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLIEVHDRHELERAYKVNAKL
IGVNNRDLKRFVTNVEHTNTILENKKPNHHYISESGIHDASDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttagcagaaattgttaaatataaacagtcacttttacaaaatggctattat
caagacaaacttaataccttgaaaagtgtgaagattcagaataaaaaatcttttataaac
gcaattgagaaagaaccaaagctagcaattattgcagaaattaaatcgaagagtcctaca
gttaatgacttacctgaacgagatttatcgcaacaaatctcagattatgaaaagtacggt
gcaaatgccgtgtccattttaactgatgaaaagtactttggtggtagttttgaaagatta
caagcattgacaacaaaaacaacattacccgtattatgcaaagactttattatagacccg
cttcaaattgatgttgctaaacaagctggtgcatctatgattttattgatcgttaacatc
ttatcggataaacaattgaaagatttatataactacgctatatcgcaaaatctagaagtg
ttaattgaagtacatgatcgccatgaattagaacgtgcctataaggttaatgctaaattg
attggtgtaaataacagggacttaaaacgatttgtcacaaatgtggaacatacaaatact
attttagaaaataaaaaacccaatcatcattatatttctgaaagtggtattcacgatgca
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgtgacaatctatctgaatttttaccacaactgaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system