KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_1398Help
Entry
ECTR2_1398        CDS       T01887                                 

Definition
(GenBank) glucokinase (Glucose kinase)
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
suc00010  Glycolysis / Gluconeogenesis
suc00052  Galactose metabolism
suc00500  Starch and sucrose metabolism
suc00520  Amino sugar and nucleotide sugar metabolism
suc00521  Streptomycin biosynthesis
suc01100  Metabolic pathways
suc01110  Biosynthesis of secondary metabolites
suc01120  Microbial metabolism in diverse environments
suc01130  Biosynthesis of antibiotics
suc01200  Carbon metabolism
Module
suc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECTR2_1398
   00052 Galactose metabolism
    ECTR2_1398
   00500 Starch and sucrose metabolism
    ECTR2_1398
   00520 Amino sugar and nucleotide sugar metabolism
    ECTR2_1398
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECTR2_1398
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ECTR2_1398
Enzymes [BR:suc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECTR2_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: CBX34778
Position
complement(1536592..1537578)
Genome map
AA seq 328 aa AA seqDB search
MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
GRSGCIETVASATGVVNLINFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
QAKLGNDAGITGAAGLIKTYVLDKEGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattttagcagctgatgtaggcgggacgacttgtaaattaggtattttc
acacctgaattagaacaattacataaatggtctattcacactgatacatctgatagtaca
ggatatacacttttgaaaggaatttatgattcgtttgttgaaaaagtaaatgaaaataat
tataatttttcaaatgtacttggcgtaggtattggtgtaccaggtcctgttgactttgaa
aaaggtacagtaaatggagcagtaaacttatattggccagaaaaagttaatgtacgtgag
atttttgaacaattcgttgattgtccagtgtatgtagataatgatgctaacatagctgct
ttaggggagaaacacaaaggtgctggtgaaggtgccgatgatgttgttgccatcacactt
ggtacaggtctaggtggaggaattatttcaaatggtgaaatcgtacatggtcataatggc
tctggcgcagaaataggtcattttagagcagacttcgatcaacgatttaaatgtaattgt
ggtcgttctggatgtattgaaacagttgcttcagcgacaggcgttgttaacttaattaac
ttctactatccgaagttgacgtttagatcttctatattagaattgattaaagaaaataag
gttacagcaaaagctgtttttgatgcggcaaaagctggtgaccaattctgtattttcatt
actgaaaaggttgcaaactatattggatatttatgtagtattattagtgttacaagtaat
ccgaaatatatcgttctaggtggaggaatgtctactgcaggacctattttaattgaaaat
attaaaacagaatatcataatttaacatttgcacctgctcaatttgaaactgaaattgta
caagcgaaattaggtaatgatgcaggtattacaggagcagcaggattaatcaagacctat
gtattagataaagagggggtaaaataa

DBGET integrated database retrieval system