KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_1437Help
Entry
ECTR2_1437        CDS       T01887                                 

Definition
DNA internalization-related competence protein ComEC/Rec2
Orthology
K02238  
competence protein ComEC
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Module
Competence-related DNA transformation transporter
Brite
Secretion system [BR:suc02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) family protein [MD:M00429]
   ECTR2_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1576755..1578902)
Genome map
AA seq 715 aa AA seqDB search
MLSTFLFILLLYITYRKNKIVYAPISLFLIIFSSWYLHYSQQAIFNYINYIERNSQFNER
AQVIQIQRQGSDTYKGRLSLKNEIYPFFLTDKKNFDLKKIESRNCIVKGQFKVNENKFVT
LKLQSIVVQSCLESNRSNLIEKHKQFIMNRIYDSGIKFPDRIMALITGDVKEINEQFKER
VKEIGIYHLLAVSGSHIAAIVFLIYQPLKRLNLPLFVIKGITIIVLTLYAQYTNYAPSAV
RAIIMTTLVLLITKQIKIKGIQLLAFAFIIMFILNPLVVYDIGFQFSFIISFFIMLLFPF
LQQLSKLQSLFIITFIAQLASFIVAIPNFHQLQWVGFLSNLIFVPYYSIILFPLSILFFI
TSHFIVGLTPLNYLVDLSFNFHDWLLDLFTRIKQSHFSVPKFNDWIFIIFIISVYYIFWL
LAKRKYILVTFWTIIILTLLITFPTNSHHKITMLNVGQGDSILYEGGKNQNVLIDTGGKV
IDDTKQPSYSISKYHILPTLNERGINELEYLILTHPHNDHIGEVEYIISHIKIKHIVIYN
KGYSSNTLMLLSKLSHKYNIKLMDVRQVSSFKLGDSSFLFFDSFIPNSRDKNEYSIITMI
TYQNKKVLLMGDASKNNESLLLKKYNLPEIDILKVGHHGSKTSSSKEFIEMIKPKISLIS
SGKNNMYHLPNIEVVKRLQRIRSRIYNSQQNGQVTIDLDDNLKVDSNSYGNASGL
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
gtgctctctacatttcttttcattttacttttgtatattacttatcgtaaaaataaaatc
gtttatgcccctatttctctctttttaatcattttctcctcatggtatttacattattca
caacaagcaatatttaattatatcaattatattgaacgtaattctcagtttaatgagcgt
gctcaagtaatccaaattcaacgtcaaggtagtgacacatataaaggtaggttgagttta
aaaaatgaaatatatcctttctttttaacagataaaaagaattttgatttaaagaaaatt
gaaagtcgtaattgtattgttaaaggacaattcaaagttaatgaaaataagtttgtaact
cttaaattacaaagtatagttgtacaaagctgcctagaatcgaaccggtctaatttaatt
gagaaacataaacagtttataatgaatcgaatttatgattcgggtattaagtttccggat
cgtattatggcattgattactggtgacgtaaaagaaattaatgagcaatttaaggaacgt
gttaaagagataggtatatatcatttgctggcagttagtggctcgcatatagctgcaatt
gtattcttaatttaccaacctttaaaacgattaaatttacctttatttgtcattaaagga
attacaatcattgtattaactttatatgctcaatacacaaattatgcacctagtgctgta
agagctataataatgacaactcttgtactgcttattactaagcaaattaaaataaagggt
attcagctattagcatttgcatttataattatgtttattttaaacccactagttgtttat
gatattggatttcaattttcattcatcatttcattttttattatgctactttttcctttt
ttacagcaattgtcaaagttacaatcattattcataattacgtttattgcacaattagct
tcatttatcgttgccattccaaactttcatcaacttcaatgggtgggatttttatctaat
ttgatttttgtaccgtactattcgattatattgtttccgctatctattttattctttatt
acaagtcattttattgtgggattaacgccgctaaattacttggttgacctaagttttaat
tttcatgactggttactagacctattcacaagaattaagcaatcacatttttctgttccc
aagtttaatgattggatatttataatatttataatttctgtttattacatattttggtta
ttggctaaacgtaaatatatattggttacgttttggactataattattctgacattatta
ataacgtttccaacaaattcacatcacaaaattacaatgttaaatgtggggcagggagac
agtattttatatgaaggcggtaagaaccaaaatgtcttgattgatacaggtgggaaagtg
attgatgatactaaacaacctagttattcaatttctaaatatcatattttaccaacgcta
aatgaaagagggataaatgaattagagtatctaattttaacacatccacacaatgaccat
attggtgaagtggaatatattattagtcatattaaaattaaacatatagtgatatacaat
aagggatatagtagtaatacattgatgttattatcgaaattaagccataagtacaacatt
aaacttatggatgtaagacaagttagtagttttaaacttggagatagtagttttctattt
tttgatagttttattccaaatagccgagataaaaatgagtattcgattattactatgatt
acatatcaaaataaaaaagttttattaatgggcgatgctagtaaaaataatgaatcttta
ctactaaaaaaatataacttgccggagattgatattttaaaagtaggacatcatgggagc
aagacaagtagttctaaagaatttatagagatgattaagcctaaaataagtttgatttct
tctgggaagaacaatatgtatcatcttcctaatatagaagttgttaaacgattgcaaagg
attcgcagtcgcatttacaatagtcaacaaaacggtcaagttacaattgacttagatgat
aatttaaaagttgattcaaactcttatggaaatgcaagtggtttatag

DBGET integrated database retrieval system