KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_1510Help
Entry
ECTR2_1510        CDS       T01887                                 

Definition
uroporphyrinogen-III synthase HemD family protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECTR2_1510
Enzymes [BR:suc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ECTR2_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649045..1649713)
Genome map
AA seq 222 aa AA seqDB search
MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLIFSSKNAVKFFYKYL
KGINVDNIAVIGSKTAQYCESLGIRVDFMPNDFSQEGFLKSFNQTNQKILLPSSELARPL
LLAALSKDNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
FKSYFAIGEQTARTIKTYQQPVTIAEIQTLESLIEKILESRG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagttgtagttatgacacaaacaaatgacatgcaaagtgatttagtatcaatt
attcacaaaccctttattgatataaagccactaaattttgatattcatttgttaaatcaa
cgctatgactggcttattttttcatctaaaaatgctgtgaaattcttttataaatatcta
aaaggaattaatgttgataacattgctgtgataggaagtaagacagcgcaatattgtgaa
tcacttggcattcgagttgattttatgccaaacgacttttctcaagaaggatttttaaaa
tcatttaatcaaactaaccaaaaaatacttttgccttcgagtgaattggcgagaccattg
ttattagcagcgttatctaaagataatgaagttgttaaaatagatttatatacttcagtg
cctaacaaacaaaatatacaagatgttaaagaaatgatagaacatcaacaaatcgatgca
ttaacattttcaagttcgtcggcagtacgttattattttaatgaaggatttgtaccaaaa
ttcaagtcgtattttgctattggagaacaaacagcacggaccattaaaacatatcaacaa
ccagtaacaattgcagaaattcaaacactcgaatcactaattgaaaagattttagaaagt
aggggctaa

DBGET integrated database retrieval system