KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_1591Help
Entry
ECTR2_1591        CDS       T01887                                 

Definition
dipeptidase, family protein (EC:3.4.13.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:suc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:suc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1748620..1750029)
Genome map
AA seq 469 aa AA seqDB search
MWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTT
HDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPT
IAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIH
GEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFE
YFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFV
AFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKA
MDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYAR
NLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagaaaaagttcaacaatacgaagatcaaatcattaatgacttaaaaggatta
ttagcaattgaaagtgtgagagatgatgcaaaagcatcagaagacgcaccagttggtcca
ggtcctcgtaaggcattagactacatgtatgaaattgcacatagagatggatttacaaca
catgatgtggatcatattgcaggaagaattgaggcaggtaaaggaaatgacgtattaggt
atcttatgtcatgttgacgttgttcctgctggtgatggatgggatagtaatccgttcgag
ccggttgtaacagaagatgctatcatagctagaggtacacttgatgacaaaggtccaaca
attgctgcttattatgcaattaagatattagaagatatgaatgtggattggaagaaacgt
attcatatgattattggtacggatgaagaatctgattggaaatgtacggatcgctatttt
aaaacagaagaaatgccaacattaggttttgcaccagatgcagaatttccatgtattcat
ggtgaaaaaggcattacaacatttgatttagttcaaaataaacttactgaagatcaagat
gaacctgattatgaattaataacttttaaatctggtgaacgttacaacatggtacctgat
catgcagaagcaagagtgcttgttaaagaaaatatgacagatgttattcaagactttgag
tactttttagaacaaaatcatttacaaggtgatagtactgttgatagtggcattctagtt
ttaacagttgaaggtaaagcggttcatggtatggatccatctatcggtgtgaatgcgggt
ctttacttactaaaattcttagcatcattaaatcttgataataatgcacaagcgtttgta
gcatttagtaatcgctacttatttaattcagattttggtgaaaagatgggaatgaaattc
catacagatgtcatgggtgacgtgacaactaacattggtgttattacatatgataatgaa
aacgcaggtcttttcggtatcaacttacgctacccagaaggatttgaatttgaaaaagct
atggatcgttttgcaaatgagattcaacaatatggctttgaagtgaaattaggtaaagtc
caaccaccacattatgttgataaaaatgatccttttgtacaaaagttagttactgcatat
agaaatcaaacaaatgatatgactgaaccttatactataggtggcggtacttatgcgaga
aacttagacaagggtgtagcatttggcgcaatgtttagtgattctgaagatttaatgcat
cagaaaaatgaatatatcactaaaaaacagttatttaacgcaactagtatttacttagaa
gcaatttattcattatgcgtggaggaataa

DBGET integrated database retrieval system