KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_2275Help
Entry
ECTR2_2275        CDS       T01887                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Phosphoglyceromutase) (PGAM) (BPG-dependent PGAM) (dPGM)
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
suc00010  Glycolysis / Gluconeogenesis
suc00260  Glycine, serine and threonine metabolism
suc00680  Methane metabolism
suc01100  Metabolic pathways
suc01110  Biosynthesis of secondary metabolites
suc01120  Microbial metabolism in diverse environments
suc01130  Biosynthesis of antibiotics
suc01200  Carbon metabolism
suc01230  Biosynthesis of amino acids
Module
suc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suc_M00002  Glycolysis, core module involving three-carbon compounds
suc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECTR2_2275
  Energy metabolism
   00680 Methane metabolism
    ECTR2_2275
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECTR2_2275
Enzymes [BR:suc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECTR2_2275
Membrane trafficking [BR:suc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECTR2_2275
Exosome [BR:suc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECTR2_2275
  Exosomal proteins of melanoma cells
   ECTR2_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBX35604
Position
complement(2396458..2397144)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattaattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system