KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_2275Help
Entry
ECTR2_2275        CDS       T01887                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Phosphoglyceromutase) (PGAM) (BPG-dependent PGAM) (dPGM) (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECTR2_2275
   01230 Biosynthesis of amino acids
    ECTR2_2275
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECTR2_2275
  Energy metabolism
   00680 Methane metabolism
    ECTR2_2275
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECTR2_2275
Enzymes [BR:suc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECTR2_2275
Exosome [BR:suc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECTR2_2275
  Exosomal proteins of melanoma cells
   ECTR2_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2396458..2397144)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattaattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system