KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_2353Help
Entry
ECTR2_2353        CDS       T01887                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECTR2_2353 (galU)
   00052 Galactose metabolism
    ECTR2_2353 (galU)
   00500 Starch and sucrose metabolism
    ECTR2_2353 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ECTR2_2353 (galU)
Enzymes [BR:suc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECTR2_2353 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2487356..2488150)
Genome map
AA seq 264 aa AA seqDB search
MPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKS
ELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVPAVKQ
LIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNGRQYEVKKFVEKPAQGTAPSNLAIM
GRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKT
TIEYALKDDSMREELTRFIKALGL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaggaaatgcttcctatcttagataaacccacaatacaatatatcgttgaagaa
gctgcaagagctggaattgaagatattattatagtgacaggtcgccacaaacgcgcgatt
gaagatcattttgatagtcaaaaagaattagaaatggtgttaaaagaaaaaggtaaatct
gaattactagaaaaagttcaatactcgacagaacttgcgaatattttttatgtaagacag
aaagaacaaaaaggtttagggcatgcgattagttctgcgcgtcaatttatcggcaatgaa
ccatttgcggtattattaggtgacgatattgttgaatctgaagtgccagcagtgaaacag
ttgattgacgtttatgaagaaacggggcactcagttataggtgtccaagaagttccggaa
gcagatactcatcgttatggaattattgatccattaactaaaaatggacgtcagtatgaa
gtgaaaaagtttgttgaaaagccagcacaaggtacggcaccatcaaacctagctattatg
ggccgatatgtattaacgcctgaaattttcgattatttaaaaacgcaaaaagaaggcgca
ggtaacgaaattcagttaacagatgcgattgagcgtatgaacaatgataatcaagtgtat
gcatatgacttcgaaggcgaacgttatgacgttggagaaaaattaggatttgtcaaaaca
acaatagaatatgcgttgaaagatgacagtatgcgagaagaattaacacgatttattaaa
gcattaggtttataa

DBGET integrated database retrieval system