KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_2353Help
Entry
ECTR2_2353        CDS       T01887                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECTR2_2353 (galU)
   00052 Galactose metabolism
    ECTR2_2353 (galU)
   00500 Starch and sucrose metabolism
    ECTR2_2353 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ECTR2_2353 (galU)
Enzymes [BR:suc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECTR2_2353 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2487356..2488150)
Genome map
AA seq 264 aa AA seqDB search
MPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKS
ELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVPAVKQ
LIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNGRQYEVKKFVEKPAQGTAPSNLAIM
GRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKT
TIEYALKDDSMREELTRFIKALGL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaggaaatgcttcctatcttagataaacccacaatacaatatatcgttgaagaa
gctgcaagagctggaattgaagatattattatagtgacaggtcgccacaaacgcgcgatt
gaagatcattttgatagtcaaaaagaattagaaatggtgttaaaagaaaaaggtaaatct
gaattactagaaaaagttcaatactcgacagaacttgcgaatattttttatgtaagacag
aaagaacaaaaaggtttagggcatgcgattagttctgcgcgtcaatttatcggcaatgaa
ccatttgcggtattattaggtgacgatattgttgaatctgaagtgccagcagtgaaacag
ttgattgacgtttatgaagaaacggggcactcagttataggtgtccaagaagttccggaa
gcagatactcatcgttatggaattattgatccattaactaaaaatggacgtcagtatgaa
gtgaaaaagtttgttgaaaagccagcacaaggtacggcaccatcaaacctagctattatg
ggccgatatgtattaacgcctgaaattttcgattatttaaaaacgcaaaaagaaggcgca
ggtaacgaaattcagttaacagatgcgattgagcgtatgaacaatgataatcaagtgtat
gcatatgacttcgaaggcgaacgttatgacgttggagaaaaattaggatttgtcaaaaca
acaatagaatatgcgttgaaagatgacagtatgcgagaagaattaacacgatttattaaa
gcattaggtttataa

DBGET integrated database retrieval system