KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_2475Help
Entry
ECTR2_2475        CDS       T01887                                 

Definition
(GenBank) peroxiredoxin HYR1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
suc00480  Glutathione metabolism
suc00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ECTR2_2475
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ECTR2_2475
Enzymes [BR:suc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ECTR2_2475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF2691 SCO1-SenC
Motif
Other DBs
NCBI-ProteinID: CBX35804
Position
complement(2623003..2623500)
Genome map
AA seq 165 aa AA seqDB search
MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagaaatgtgtatgatatcgaagtaagtgattataaaggcttaacttataaa
ttagaagcatttagaggtaaagtgattttagttgttaatactgcaacagaatgtatatat
agcgaacaattgaaaaaactagagactttgtttcaaaaatataaggatcgtgggtttgta
gtgttgagttttccgaataataattttgacaatcgacaaccaggttctaatgaagaaatc
ttgaaaattagtcgtgagaaatttggtgttacatttccagtgctagctaaaatatctgtg
aacgggaacgatgaacatccgttatttacgcatttaaagaatgaacaaccaggaatcttt
gggtccccaataaaatggaatttcacaaaatttataatcgatcgacaaggcaatgttgta
aatcgattcttgccaatggaagatccattggatatatcgacaaatatagaaatattattg
caagaatcttcatcttaa

DBGET integrated database retrieval system