KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_558Help
Entry
ECTR2_558         CDS       T01887                                 

Definition
(GenBank) alcohol dehydrogenase 1 (Alcohol dehydrogenase I) (ADHI)
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
suc00010  Glycolysis / Gluconeogenesis
suc00071  Fatty acid degradation
suc00350  Tyrosine metabolism
suc00625  Chloroalkane and chloroalkene degradation
suc00626  Naphthalene degradation
suc01100  Metabolic pathways
suc01110  Biosynthesis of secondary metabolites
suc01120  Microbial metabolism in diverse environments
suc01130  Biosynthesis of antibiotics
suc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECTR2_558
  Lipid metabolism
   00071 Fatty acid degradation
    ECTR2_558
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECTR2_558
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECTR2_558
   00626 Naphthalene degradation
    ECTR2_558
Enzymes [BR:suc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECTR2_558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C BKACE Methyltransf_11 ADH_N_2 Methyltransf_25 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: CBX33942
Position
620935..621945
Genome map
AA seq 336 aa AA seqDB search
MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQ
VIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNVKPGQWLGVFGIGGLGNLALQY
AKNVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNKGLDATVVTSVA
KTPFNQAVDVVKAGARVVAVGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQDLREAFEFAA
ENKVTPKVQLRKLEEINDIFEEMENGTITGRMVIKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagttgtaacgaaagatcacaaagtaagtattgaggacaaaaagttaaga
gctttaaaacctggtgaagcattggtacaaacggaatattgtggtgtttgtcataccgat
ttacatgttaagaatgctgattttggtgatgttacaggcgttactttaggtcatgaaggt
attggtaaagtcatcgaagttgcagaagatgtagaatcattaaaaattggagaccgtgtg
tctatcgcttggatgttcgaaagctgtggaagatgtgaatattgtacaacaggtcgtgaa
acactttgccgtagtgtgaaaaatgctggttatacagtagatggtgcaatggctgaacaa
gttattgttactgcagactatgctgtgaaagtacctgaaaaattagatccagcagcagcg
tcttctattacatgcgcaggtgtgacaacttataaagctgtaaaagtaagtaatgtaaaa
cctggtcaatggttaggtgtttttggtataggtggtttaggtaacctagctttacaatat
gctaaaaacgttatgggggctaaaattgttgccttcgacattaatgatgataaattagca
ttcgcgaaagaattaggtgcagatgctattattaattctaaagatgttgatccagttgca
gaagttatgaaattaactgataacaaaggattagatgcaacagtggtaacttcagttgct
aagacgccatttaaccaagcggttgatgttgtaaaagctggtgcaagagttgttgccgtt
ggtttacctgttgataaaatgaacttagatatcccaagattagtgcttgacggtattgaa
gtagtaggttcacttgttggtacaagacaagacttacgtgaagcgtttgaatttgctgct
gaaaataaagtaacacctaaagttcaattaagaaaattagaagaaatcaatgatattttt
gaagaaatggaaaatggtactataactggtagaatggttattaaattttaa

DBGET integrated database retrieval system