KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_725Help
Entry
ECTR2_725         CDS       T01887                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
suc00010  Glycolysis / Gluconeogenesis
suc00051  Fructose and mannose metabolism
suc00562  Inositol phosphate metabolism
suc01100  Metabolic pathways
suc01110  Biosynthesis of secondary metabolites
suc01120  Microbial metabolism in diverse environments
suc01130  Biosynthesis of antibiotics
suc01200  Carbon metabolism
suc01230  Biosynthesis of amino acids
Module
suc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suc_M00002  Glycolysis, core module involving three-carbon compounds
suc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECTR2_725 (tpiA)
   00051 Fructose and mannose metabolism
    ECTR2_725 (tpiA)
   00562 Inositol phosphate metabolism
    ECTR2_725 (tpiA)
Enzymes [BR:suc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECTR2_725 (tpiA)
Exosome [BR:suc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECTR2_725 (tpiA)
  Exosomal proteins of bladder cancer cells
   ECTR2_725 (tpiA)
  Exosomal proteins of melanoma cells
   ECTR2_725 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBX34108
Structure
PDB: 

Jmol
Position
800355..801116
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattaccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggtcattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcacgctattttcaaa
catggaatgactccaattatttgtgttggtgaaacagacgaagagcgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaagatcaa
cttaaatcagttgtaattgcttatgagccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcaaatgaaatgtgtgcatttgtacgtcaaactattgctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system